Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2658807..2659027 Replicon chromosome
Accession NZ_CP047876
Organism Escherichia coli strain LD22-1

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag GUU87_RS12735 Protein ID WP_000170965.1
Coordinates 2658920..2659027 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2658807..2658873 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GUU87_RS12710 2654086..2655480 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
GUU87_RS12715 2655665..2656018 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
GUU87_RS12720 2656062..2656757 - 696 WP_160183905.1 glutathione-specific gamma-glutamylcyclotransferase -
GUU87_RS12725 2656915..2657145 - 231 WP_001146442.1 putative cation transport regulator ChaB -
GUU87_RS12730 2657415..2658515 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2658807..2658873 - 67 - - Antitoxin
GUU87_RS12735 2658920..2659027 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2659340..2659403 - 64 NuclAT_34 - -
- 2659340..2659403 - 64 NuclAT_34 - -
- 2659340..2659403 - 64 NuclAT_34 - -
- 2659340..2659403 - 64 NuclAT_34 - -
- 2659340..2659403 - 64 NuclAT_36 - -
- 2659340..2659403 - 64 NuclAT_36 - -
- 2659340..2659403 - 64 NuclAT_36 - -
- 2659340..2659403 - 64 NuclAT_36 - -
- 2659340..2659403 - 64 NuclAT_38 - -
- 2659340..2659403 - 64 NuclAT_38 - -
- 2659340..2659403 - 64 NuclAT_38 - -
- 2659340..2659403 - 64 NuclAT_38 - -
- 2659340..2659403 - 64 NuclAT_40 - -
- 2659340..2659403 - 64 NuclAT_40 - -
- 2659340..2659403 - 64 NuclAT_40 - -
- 2659340..2659403 - 64 NuclAT_40 - -
- 2659340..2659403 - 64 NuclAT_42 - -
- 2659340..2659403 - 64 NuclAT_42 - -
- 2659340..2659403 - 64 NuclAT_42 - -
- 2659340..2659403 - 64 NuclAT_42 - -
- 2659340..2659403 - 64 NuclAT_44 - -
- 2659340..2659403 - 64 NuclAT_44 - -
- 2659340..2659403 - 64 NuclAT_44 - -
- 2659340..2659403 - 64 NuclAT_44 - -
- 2659341..2659403 - 63 NuclAT_46 - -
- 2659341..2659403 - 63 NuclAT_46 - -
- 2659341..2659403 - 63 NuclAT_46 - -
- 2659341..2659403 - 63 NuclAT_46 - -
- 2659341..2659403 - 63 NuclAT_49 - -
- 2659341..2659403 - 63 NuclAT_49 - -
- 2659341..2659403 - 63 NuclAT_49 - -
- 2659341..2659403 - 63 NuclAT_49 - -
- 2659342..2659403 - 62 NuclAT_16 - -
- 2659342..2659403 - 62 NuclAT_16 - -
- 2659342..2659403 - 62 NuclAT_16 - -
- 2659342..2659403 - 62 NuclAT_16 - -
- 2659342..2659403 - 62 NuclAT_19 - -
- 2659342..2659403 - 62 NuclAT_19 - -
- 2659342..2659403 - 62 NuclAT_19 - -
- 2659342..2659403 - 62 NuclAT_19 - -
- 2659342..2659403 - 62 NuclAT_22 - -
- 2659342..2659403 - 62 NuclAT_22 - -
- 2659342..2659403 - 62 NuclAT_22 - -
- 2659342..2659403 - 62 NuclAT_22 - -
- 2659342..2659403 - 62 NuclAT_25 - -
- 2659342..2659403 - 62 NuclAT_25 - -
- 2659342..2659403 - 62 NuclAT_25 - -
- 2659342..2659403 - 62 NuclAT_25 - -
- 2659342..2659403 - 62 NuclAT_28 - -
- 2659342..2659403 - 62 NuclAT_28 - -
- 2659342..2659403 - 62 NuclAT_28 - -
- 2659342..2659403 - 62 NuclAT_28 - -
- 2659342..2659403 - 62 NuclAT_31 - -
- 2659342..2659403 - 62 NuclAT_31 - -
- 2659342..2659403 - 62 NuclAT_31 - -
- 2659342..2659403 - 62 NuclAT_31 - -
GUU87_RS12740 2659456..2659563 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2659877..2659943 - 67 NuclAT_45 - -
- 2659877..2659943 - 67 NuclAT_45 - -
- 2659877..2659943 - 67 NuclAT_45 - -
- 2659877..2659943 - 67 NuclAT_45 - -
- 2659877..2659943 - 67 NuclAT_48 - -
- 2659877..2659943 - 67 NuclAT_48 - -
- 2659877..2659943 - 67 NuclAT_48 - -
- 2659877..2659943 - 67 NuclAT_48 - -
- 2659878..2659941 - 64 NuclAT_17 - -
- 2659878..2659941 - 64 NuclAT_17 - -
- 2659878..2659941 - 64 NuclAT_17 - -
- 2659878..2659941 - 64 NuclAT_17 - -
- 2659878..2659941 - 64 NuclAT_20 - -
- 2659878..2659941 - 64 NuclAT_20 - -
- 2659878..2659941 - 64 NuclAT_20 - -
- 2659878..2659941 - 64 NuclAT_20 - -
- 2659878..2659941 - 64 NuclAT_23 - -
- 2659878..2659941 - 64 NuclAT_23 - -
- 2659878..2659941 - 64 NuclAT_23 - -
- 2659878..2659941 - 64 NuclAT_23 - -
- 2659878..2659941 - 64 NuclAT_26 - -
- 2659878..2659941 - 64 NuclAT_26 - -
- 2659878..2659941 - 64 NuclAT_26 - -
- 2659878..2659941 - 64 NuclAT_26 - -
- 2659878..2659941 - 64 NuclAT_29 - -
- 2659878..2659941 - 64 NuclAT_29 - -
- 2659878..2659941 - 64 NuclAT_29 - -
- 2659878..2659941 - 64 NuclAT_29 - -
- 2659878..2659941 - 64 NuclAT_32 - -
- 2659878..2659941 - 64 NuclAT_32 - -
- 2659878..2659941 - 64 NuclAT_32 - -
- 2659878..2659941 - 64 NuclAT_32 - -
GUU87_RS12745 2659991..2660098 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
GUU87_RS12750 2660247..2661101 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
GUU87_RS12755 2661137..2661946 - 810 WP_001257044.1 invasion regulator SirB1 -
GUU87_RS12760 2661950..2662342 - 393 WP_089078767.1 invasion regulator SirB2 -
GUU87_RS12765 2662339..2663172 - 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T148471 WP_000170965.1 NZ_CP047876:2658920-2659027 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T148471 NZ_CP063701:c56770-56465 [Salmonella enterica subsp. enterica serovar Enteritidis]
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT

Antitoxin


Download         Length: 67 bp

>AT148471 NZ_CP047876:c2658873-2658807 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References