Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 2658807..2659027 | Replicon | chromosome |
Accession | NZ_CP047876 | ||
Organism | Escherichia coli strain LD22-1 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | B7LGX8 |
Locus tag | GUU87_RS12735 | Protein ID | WP_000170965.1 |
Coordinates | 2658920..2659027 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 2658807..2658873 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GUU87_RS12710 | 2654086..2655480 | - | 1395 | WP_000086201.1 | inverse autotransporter invasin YchO | - |
GUU87_RS12715 | 2655665..2656018 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
GUU87_RS12720 | 2656062..2656757 | - | 696 | WP_160183905.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
GUU87_RS12725 | 2656915..2657145 | - | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
GUU87_RS12730 | 2657415..2658515 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
- | 2658807..2658873 | - | 67 | - | - | Antitoxin |
GUU87_RS12735 | 2658920..2659027 | + | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 2659340..2659403 | - | 64 | NuclAT_34 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_34 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_34 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_34 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_36 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_36 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_36 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_36 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_38 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_38 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_38 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_38 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_40 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_40 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_40 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_40 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_42 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_42 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_42 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_42 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_44 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_44 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_44 | - | - |
- | 2659340..2659403 | - | 64 | NuclAT_44 | - | - |
- | 2659341..2659403 | - | 63 | NuclAT_46 | - | - |
- | 2659341..2659403 | - | 63 | NuclAT_46 | - | - |
- | 2659341..2659403 | - | 63 | NuclAT_46 | - | - |
- | 2659341..2659403 | - | 63 | NuclAT_46 | - | - |
- | 2659341..2659403 | - | 63 | NuclAT_49 | - | - |
- | 2659341..2659403 | - | 63 | NuclAT_49 | - | - |
- | 2659341..2659403 | - | 63 | NuclAT_49 | - | - |
- | 2659341..2659403 | - | 63 | NuclAT_49 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_16 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_16 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_16 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_16 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_19 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_19 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_19 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_19 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_22 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_22 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_22 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_22 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_25 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_25 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_25 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_25 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_28 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_28 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_28 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_28 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_31 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_31 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_31 | - | - |
- | 2659342..2659403 | - | 62 | NuclAT_31 | - | - |
GUU87_RS12740 | 2659456..2659563 | + | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 2659877..2659943 | - | 67 | NuclAT_45 | - | - |
- | 2659877..2659943 | - | 67 | NuclAT_45 | - | - |
- | 2659877..2659943 | - | 67 | NuclAT_45 | - | - |
- | 2659877..2659943 | - | 67 | NuclAT_45 | - | - |
- | 2659877..2659943 | - | 67 | NuclAT_48 | - | - |
- | 2659877..2659943 | - | 67 | NuclAT_48 | - | - |
- | 2659877..2659943 | - | 67 | NuclAT_48 | - | - |
- | 2659877..2659943 | - | 67 | NuclAT_48 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_17 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_17 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_17 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_17 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_20 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_20 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_20 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_20 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_23 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_23 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_23 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_23 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_26 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_26 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_26 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_26 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_29 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_29 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_29 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_29 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_32 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_32 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_32 | - | - |
- | 2659878..2659941 | - | 64 | NuclAT_32 | - | - |
GUU87_RS12745 | 2659991..2660098 | + | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
GUU87_RS12750 | 2660247..2661101 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
GUU87_RS12755 | 2661137..2661946 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
GUU87_RS12760 | 2661950..2662342 | - | 393 | WP_089078767.1 | invasion regulator SirB2 | - |
GUU87_RS12765 | 2662339..2663172 | - | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T148471 WP_000170965.1 NZ_CP047876:2658920-2659027 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T148471 NZ_CP063701:c56770-56465 [Salmonella enterica subsp. enterica serovar Enteritidis]
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
Antitoxin
Download Length: 67 bp
>AT148471 NZ_CP047876:c2658873-2658807 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|