Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2419434..2419618 | Replicon | chromosome |
Accession | NZ_CP047859 | ||
Organism | Staphylococcus aureus strain UP_1405 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | E3S65_RS11975 | Protein ID | WP_000482652.1 |
Coordinates | 2419434..2419541 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2419558..2419618 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3S65_RS11950 | 2414796..2415269 | + | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
E3S65_RS11955 | 2415392..2416603 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
E3S65_RS11960 | 2416785..2417444 | - | 660 | WP_000831298.1 | membrane protein | - |
E3S65_RS11965 | 2417504..2418646 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
E3S65_RS11970 | 2418914..2419300 | + | 387 | WP_000779360.1 | flippase GtxA | - |
E3S65_RS11975 | 2419434..2419541 | + | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2419558..2419618 | - | 61 | - | - | Antitoxin |
E3S65_RS11980 | 2420244..2422007 | + | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
E3S65_RS11985 | 2422032..2423765 | + | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
E3S65_RS11990 | 2423996..2424163 | + | 168 | Protein_2323 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T148377 WP_000482652.1 NZ_CP047859:2419434-2419541 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T148377 NZ_CP063503:c4759247-4759140 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 61 bp
>AT148377 NZ_CP047859:c2419618-2419558 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|