Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2423919..2424103 | Replicon | chromosome |
Accession | NZ_CP047854 | ||
Organism | Staphylococcus aureus strain UP_1525 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | E3S68_RS11985 | Protein ID | WP_000482652.1 |
Coordinates | 2423919..2424026 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2424043..2424103 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3S68_RS11960 | 2419281..2419754 | + | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
E3S68_RS11965 | 2419877..2421088 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
E3S68_RS11970 | 2421270..2421929 | - | 660 | WP_000831298.1 | membrane protein | - |
E3S68_RS11975 | 2421989..2423131 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
E3S68_RS11980 | 2423399..2423785 | + | 387 | WP_000779360.1 | flippase GtxA | - |
E3S68_RS11985 | 2423919..2424026 | + | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2424043..2424103 | - | 61 | - | - | Antitoxin |
E3S68_RS11990 | 2424729..2426492 | + | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
E3S68_RS11995 | 2426517..2428250 | + | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
E3S68_RS12000 | 2428481..2428648 | + | 168 | Protein_2326 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T148339 WP_000482652.1 NZ_CP047854:2423919-2424026 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T148339 NZ_CP063499:769937-770040 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 61 bp
>AT148339 NZ_CP047854:c2424103-2424043 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|