Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2336341..2336525 | Replicon | chromosome |
Accession | NZ_CP047847 | ||
Organism | Staphylococcus aureus strain UP_522 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | E3S80_RS11630 | Protein ID | WP_000482647.1 |
Coordinates | 2336341..2336448 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2336465..2336525 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3S80_RS11605 | 2331713..2332186 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
E3S80_RS11610 | 2332309..2333520 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
E3S80_RS11615 | 2333702..2334361 | - | 660 | WP_000831298.1 | membrane protein | - |
E3S80_RS11620 | 2334421..2335563 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
E3S80_RS11625 | 2335821..2336207 | + | 387 | WP_000779360.1 | flippase GtxA | - |
E3S80_RS11630 | 2336341..2336448 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2336465..2336525 | - | 61 | - | - | Antitoxin |
E3S80_RS11635 | 2337076..2338839 | + | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein/permease | - |
E3S80_RS11640 | 2338864..2340597 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
E3S80_RS11645 | 2340828..2340995 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T148271 WP_000482647.1 NZ_CP047847:2336341-2336448 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T148271 NZ_CP063483:3388217-3388324 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 61 bp
>AT148271 NZ_CP047847:c2336525-2336465 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|