Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2469383..2469567 | Replicon | chromosome |
Accession | NZ_CP047801 | ||
Organism | Staphylococcus aureus strain UP_248 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | E3S70_RS12175 | Protein ID | WP_000482647.1 |
Coordinates | 2469383..2469490 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2469507..2469567 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3S70_RS12150 | 2464745..2465251 | + | 507 | WP_160176533.1 | GyrI-like domain-containing protein | - |
E3S70_RS12155 | 2465341..2466552 | - | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
E3S70_RS12160 | 2466734..2467393 | - | 660 | WP_031880749.1 | membrane protein | - |
E3S70_RS12165 | 2467453..2468595 | - | 1143 | WP_001176855.1 | glycerate kinase | - |
E3S70_RS12170 | 2468863..2469249 | + | 387 | WP_000779351.1 | flippase GtxA | - |
E3S70_RS12175 | 2469383..2469490 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2469507..2469567 | - | 61 | - | - | Antitoxin |
E3S70_RS12180 | 2470138..2471901 | + | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein/permease | - |
E3S70_RS12185 | 2471926..2473659 | + | 1734 | WP_000486505.1 | ABC transporter ATP-binding protein/permease | - |
E3S70_RS12190 | 2473890..2474057 | + | 168 | Protein_2368 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T147929 WP_000482647.1 NZ_CP047801:2469383-2469490 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T147929 NZ_CP063369:1469416-1469523 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 61 bp
>AT147929 NZ_CP047801:c2469567-2469507 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|