Detailed information of TA system TA147823

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/-
• Location: 2835390..2835804
• Replicon: chromosome
• Accession: NZ_CP047794
• Organism: Staphylococcus aureus strain UP_551

Toxin (Protein)

• Gene name: higB
• Uniprot ID: -
• Locus tag: E3S81_RS13975
• Protein ID: WP_001065046.1
• Coordinates: 2835390..2835641 (+)
• Length: 84 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: E3S81_RS14075
• Protein ID: WP_000028424.1
• Coordinates: 2835631..2835804 (+)
• Length: 58 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
E3S81_RS13935	2831107..2832027	+	921	WP_000138475.1	recombinase RecT	-
E3S81_RS13940	2832093..2832725	+	633	WP_106459809.1	MBL fold metallo-hydrolase	-
E3S81_RS13945	2832726..2833196	+	471	WP_106459810.1	single-stranded DNA-binding protein	-
E3S81_RS13950	2833226..2834110	+	885	WP_106459811.1	DnaD domain protein	-
E3S81_RS13955	2834117..2834335	+	219	WP_000338527.1	hypothetical protein	-
E3S81_RS13960	2834344..2834748	+	405	WP_106459812.1	RusA family crossover junction endodeoxyribonuclease	-
E3S81_RS13965	2834761..2835129	+	369	WP_000101270.1	hypothetical protein	-
E3S81_RS13970	2835133..2835375	+	243	WP_000131381.1	phi PVL orf 51-like protein	-
E3S81_RS13975	2835390..2835641	+	252	WP_001065046.1	DUF1024 family protein	Toxin
E3S81_RS14075	2835631..2835804	+	174	WP_000028424.1	hypothetical protein	Antitoxin
E3S81_RS13980	2835805..2836086	+	282	Protein_2715	hypothetical protein	-
E3S81_RS14080	2836087..2836248	+	162	WP_000889682.1	hypothetical protein	-
E3S81_RS13985	2836263..2836769	+	507	WP_001061842.1	dUTPase	-
E3S81_RS13990	2836806..2837093	+	288	WP_070046073.1	DUF1381 domain-containing protein	-
E3S81_RS13995	2837086..2837322	+	237	WP_070046072.1	hypothetical protein	-
E3S81_RS14000	2837312..2837701	+	390	WP_181426663.1	hypothetical protein	-
E3S81_RS14005	2837698..2837847	+	150	WP_000595265.1	transcriptional activator RinB	-
E3S81_RS14010	2837847..2838047	+	201	WP_106459814.1	DUF1514 family protein	-
E3S81_RS14015	2838070..2838531	+	462	WP_000282752.1	hypothetical protein	-
E3S81_RS14020	2838646..2839098	+	453	WP_000406189.1	nucleoside triphosphate pyrophosphohydrolase family protein	-
E3S81_RS14025	2839114..2839458	+	345	WP_106459818.1	HNH endonuclease	-
E3S81_RS14030	2839588..2840055	+	468	WP_000919026.1	phage terminase small subunit P27 family	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	-	-	2828050..2836248	8198

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Protein of unknown function DUF1024 (1-82)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 84 a.a.
• Molecular weight: 9377.26 Da
• Isoelectric Point: 3.7128

>T147823 WP_001065046.1 NZ_CP047794:2835390-2835641 [Staphylococcus aureus]
MNNREQIEQSIISASAYNGNDTEGLLKEVEDVYKKAQAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Nucleotide

• Length: 252 bp

>T147823 NZ_CP063332:c204183-204076 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Protein

• Length: 58 a.a.
• Molecular weight: 6468.29 Da
• Isoelectric Point: 4.2484

>AT147823 WP_000028424.1 NZ_CP047794:2835631-2835804 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Nucleotide

• Length: 174 bp

>AT147823 NZ_CP063332:204230-204296 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT