Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 1842600..1842817 | Replicon | chromosome |
Accession | NZ_CP047792 | ||
Organism | Staphylococcus aureus strain UP_794 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | E3S88_RS09230 | Protein ID | WP_001802298.1 |
Coordinates | 1842713..1842817 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 1842600..1842655 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3S88_RS09210 | 1838671..1839336 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
E3S88_RS09215 | 1839488..1839808 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
E3S88_RS09220 | 1839810..1840790 | + | 981 | WP_124779853.1 | CDF family zinc efflux transporter CzrB | - |
E3S88_RS09225 | 1841056..1842147 | + | 1092 | WP_124779851.1 | transcriptional regulator | - |
- | 1842600..1842655 | + | 56 | - | - | Antitoxin |
E3S88_RS09230 | 1842713..1842817 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
E3S88_RS09235 | 1842978..1843470 | - | 493 | Protein_1768 | recombinase family protein | - |
E3S88_RS09240 | 1843521..1844027 | - | 507 | Protein_1769 | SAP domain-containing protein | - |
E3S88_RS09245 | 1845076..1845933 | - | 858 | WP_072512359.1 | Cof-type HAD-IIB family hydrolase | - |
E3S88_RS09250 | 1846001..1846783 | - | 783 | WP_124779849.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T147780 WP_001802298.1 NZ_CP047792:c1842817-1842713 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T147780 NZ_CP047792:c1842817-1842713 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT147780 NZ_CP047792:1842600-1842655 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|