Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2357480..2357664 | Replicon | chromosome |
Accession | NZ_CP047789 | ||
Organism | Staphylococcus aureus strain UP_967 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | E3S93_RS11670 | Protein ID | WP_000482650.1 |
Coordinates | 2357480..2357587 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2357604..2357664 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3S93_RS11645 | 2352842..2353315 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
E3S93_RS11650 | 2353438..2354649 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
E3S93_RS11655 | 2354831..2355490 | - | 660 | WP_000831298.1 | membrane protein | - |
E3S93_RS11660 | 2355550..2356692 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
E3S93_RS11665 | 2356960..2357346 | + | 387 | WP_000779358.1 | flippase GtxA | - |
E3S93_RS11670 | 2357480..2357587 | + | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2357604..2357664 | - | 61 | - | - | Antitoxin |
E3S93_RS11675 | 2358215..2359978 | + | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
E3S93_RS11680 | 2360003..2361736 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
E3S93_RS11685 | 2361967..2362134 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T147725 WP_000482650.1 NZ_CP047789:2357480-2357587 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T147725 NZ_CP063229:2098279-2098375 [Serratia marcescens]
AACAAGCCCTGCATTAAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTAGACCGAATATAGGAATC
GTATTCGGTCTTTTTTT
AACAAGCCCTGCATTAAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTAGACCGAATATAGGAATC
GTATTCGGTCTTTTTTT
Antitoxin
Download Length: 61 bp
>AT147725 NZ_CP047789:c2357664-2357604 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|