Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 177592..177772 | Replicon | chromosome |
Accession | NZ_CP047788 | ||
Organism | Staphylococcus aureus strain UP_1033 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | E3S95_RS01075 | Protein ID | WP_001801861.1 |
Coordinates | 177677..177772 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 177592..177649 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3S95_RS01050 | 173005..175425 | - | 2421 | WP_000182553.1 | polysaccharide lyase 8 family protein | - |
E3S95_RS01055 | 175950..176392 | + | 443 | Protein_173 | DUF1433 domain-containing protein | - |
E3S95_RS01060 | 176392..176835 | + | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
E3S95_RS01065 | 176835..177278 | + | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
E3S95_RS01070 | 177453..177554 | - | 102 | WP_001791232.1 | hypothetical protein | - |
- | 177592..177649 | + | 58 | - | - | Antitoxin |
E3S95_RS01075 | 177677..177772 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
E3S95_RS01080 | 178223..178669 | + | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
E3S95_RS01085 | 178862..179431 | + | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
E3S95_RS01090 | 179431..180798 | + | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
E3S95_RS01095 | 180947..181519 | - | 573 | WP_000414222.1 | hypothetical protein | - |
E3S95_RS01100 | 181617..181961 | - | 345 | WP_000627550.1 | DUF3969 family protein | - |
E3S95_RS01105 | 182002..182628 | - | 627 | WP_000669038.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk / hysA | 147830..185187 | 37357 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T147698 WP_001801861.1 NZ_CP047788:c177772-177677 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T147698 NZ_CP063215:1881096-1881198 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 58 bp
>AT147698 NZ_CP047788:177592-177649 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|