Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1834359..1834543 | Replicon | chromosome |
Accession | NZ_CP047780 | ||
Organism | Staphylococcus aureus strain UP_1539 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | E3T11_RS08695 | Protein ID | WP_000482647.1 |
Coordinates | 1834359..1834466 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1834483..1834543 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3T11_RS08670 | 1829731..1830204 | + | 474 | WP_000456492.1 | GyrI-like domain-containing protein | - |
E3T11_RS08675 | 1830327..1831538 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
E3T11_RS08680 | 1831720..1832379 | - | 660 | WP_000831295.1 | hypothetical protein | - |
E3T11_RS08685 | 1832439..1833581 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
E3T11_RS08690 | 1833839..1834225 | + | 387 | WP_000779360.1 | flippase GtxA | - |
E3T11_RS08695 | 1834359..1834466 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1834483..1834543 | - | 61 | - | - | Antitoxin |
E3T11_RS08700 | 1835170..1836933 | + | 1764 | WP_001064836.1 | ABC transporter ATP-binding protein/permease | - |
E3T11_RS08705 | 1836958..1838691 | + | 1734 | WP_000486496.1 | ABC transporter ATP-binding protein/permease | - |
E3T11_RS08710 | 1838922..1839089 | + | 168 | WP_001792506.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T147580 WP_000482647.1 NZ_CP047780:1834359-1834466 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T147580 NZ_CP047780:1834359-1834466 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT147580 NZ_CP047780:c1834543-1834483 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|