Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2398265..2398449 | Replicon | chromosome |
Accession | NZ_CP047778 | ||
Organism | Staphylococcus aureus strain UP_1572 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | E3T13_RS11660 | Protein ID | WP_000482647.1 |
Coordinates | 2398265..2398372 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2398389..2398449 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3T13_RS11635 | 2393627..2394100 | + | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
E3T13_RS11640 | 2394223..2395434 | - | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
E3T13_RS11645 | 2395616..2396275 | - | 660 | WP_160187083.1 | hypothetical protein | - |
E3T13_RS11650 | 2396335..2397477 | - | 1143 | WP_001176855.1 | glycerate kinase | - |
E3T13_RS11655 | 2397745..2398131 | + | 387 | WP_000779351.1 | flippase GtxA | - |
E3T13_RS11660 | 2398265..2398372 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2398389..2398449 | - | 61 | - | - | Antitoxin |
E3T13_RS11665 | 2399020..2400783 | + | 1764 | WP_160187084.1 | ABC transporter ATP-binding protein/permease | - |
E3T13_RS11670 | 2400808..2402541 | + | 1734 | WP_000486505.1 | ABC transporter ATP-binding protein/permease | - |
E3T13_RS11675 | 2402772..2402939 | + | 168 | Protein_2266 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T147551 WP_000482647.1 NZ_CP047778:2398265-2398372 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T147551 NZ_CP063046:c4700028-4699921 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 61 bp
>AT147551 NZ_CP047778:c2398449-2398389 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|