Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 176342..176522 | Replicon | chromosome |
Accession | NZ_CP047777 | ||
Organism | Staphylococcus aureus strain UP_1632 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | E3T16_RS01095 | Protein ID | WP_001801861.1 |
Coordinates | 176427..176522 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 176342..176399 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3T16_RS01065 | 172051..172185 | + | 135 | WP_001791797.1 | hypothetical protein | - |
E3T16_RS01070 | 172349..173905 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
E3T16_RS01075 | 173898..175127 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
E3T16_RS01080 | 175579..176073 | + | 495 | Protein_176 | transposase | - |
E3T16_RS01085 | 176064..176225 | + | 162 | Protein_177 | transposase | - |
E3T16_RS01090 | 176203..176304 | - | 102 | WP_001792025.1 | hypothetical protein | - |
- | 176342..176399 | + | 58 | - | - | Antitoxin |
E3T16_RS01095 | 176427..176522 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
E3T16_RS01100 | 176667..177679 | + | 1013 | Protein_180 | IS3 family transposase | - |
E3T16_RS01105 | 177877..178449 | - | 573 | WP_000414216.1 | hypothetical protein | - |
E3T16_RS01110 | 178550..178891 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
E3T16_RS01115 | 178932..179558 | - | 627 | WP_160177496.1 | hypothetical protein | - |
E3T16_RS01120 | 179633..180628 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
E3T16_RS01125 | 180709..181359 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk / hlgA / lukD | 149509..200540 | 51031 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T147520 WP_001801861.1 NZ_CP047777:c176522-176427 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T147520 NZ_CP063019:4157336-4157554 [Klebsiella pneumoniae]
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACTTCTGTCTGGAAATTTATCCGCTAA
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACTTCTGTCTGGAAATTTATCCGCTAA
Antitoxin
Download Length: 58 bp
>AT147520 NZ_CP047777:176342-176399 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|