Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 477755..477975 | Replicon | chromosome |
Accession | NZ_CP047665 | ||
Organism | Escherichia coli strain LD26-1 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | B7LGX8 |
Locus tag | GUU86_RS02360 | Protein ID | WP_000170965.1 |
Coordinates | 477755..477862 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 477909..477975 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GUU86_RS02330 | 473610..474443 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
GUU86_RS02335 | 474440..474832 | + | 393 | WP_089078767.1 | invasion regulator SirB2 | - |
GUU86_RS02340 | 474836..475645 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
GUU86_RS02345 | 475681..476535 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
GUU86_RS02350 | 476684..476791 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 476839..476905 | + | 67 | NuclAT_45 | - | - |
- | 476839..476905 | + | 67 | NuclAT_45 | - | - |
- | 476839..476905 | + | 67 | NuclAT_45 | - | - |
- | 476839..476905 | + | 67 | NuclAT_45 | - | - |
- | 476839..476905 | + | 67 | NuclAT_48 | - | - |
- | 476839..476905 | + | 67 | NuclAT_48 | - | - |
- | 476839..476905 | + | 67 | NuclAT_48 | - | - |
- | 476839..476905 | + | 67 | NuclAT_48 | - | - |
- | 476841..476904 | + | 64 | NuclAT_17 | - | - |
- | 476841..476904 | + | 64 | NuclAT_17 | - | - |
- | 476841..476904 | + | 64 | NuclAT_17 | - | - |
- | 476841..476904 | + | 64 | NuclAT_17 | - | - |
- | 476841..476904 | + | 64 | NuclAT_20 | - | - |
- | 476841..476904 | + | 64 | NuclAT_20 | - | - |
- | 476841..476904 | + | 64 | NuclAT_20 | - | - |
- | 476841..476904 | + | 64 | NuclAT_20 | - | - |
- | 476841..476904 | + | 64 | NuclAT_23 | - | - |
- | 476841..476904 | + | 64 | NuclAT_23 | - | - |
- | 476841..476904 | + | 64 | NuclAT_23 | - | - |
- | 476841..476904 | + | 64 | NuclAT_23 | - | - |
- | 476841..476904 | + | 64 | NuclAT_26 | - | - |
- | 476841..476904 | + | 64 | NuclAT_26 | - | - |
- | 476841..476904 | + | 64 | NuclAT_26 | - | - |
- | 476841..476904 | + | 64 | NuclAT_26 | - | - |
- | 476841..476904 | + | 64 | NuclAT_29 | - | - |
- | 476841..476904 | + | 64 | NuclAT_29 | - | - |
- | 476841..476904 | + | 64 | NuclAT_29 | - | - |
- | 476841..476904 | + | 64 | NuclAT_29 | - | - |
- | 476841..476904 | + | 64 | NuclAT_32 | - | - |
- | 476841..476904 | + | 64 | NuclAT_32 | - | - |
- | 476841..476904 | + | 64 | NuclAT_32 | - | - |
- | 476841..476904 | + | 64 | NuclAT_32 | - | - |
GUU86_RS02355 | 477219..477326 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 477379..477440 | + | 62 | NuclAT_16 | - | - |
- | 477379..477440 | + | 62 | NuclAT_16 | - | - |
- | 477379..477440 | + | 62 | NuclAT_16 | - | - |
- | 477379..477440 | + | 62 | NuclAT_16 | - | - |
- | 477379..477440 | + | 62 | NuclAT_19 | - | - |
- | 477379..477440 | + | 62 | NuclAT_19 | - | - |
- | 477379..477440 | + | 62 | NuclAT_19 | - | - |
- | 477379..477440 | + | 62 | NuclAT_19 | - | - |
- | 477379..477440 | + | 62 | NuclAT_22 | - | - |
- | 477379..477440 | + | 62 | NuclAT_22 | - | - |
- | 477379..477440 | + | 62 | NuclAT_22 | - | - |
- | 477379..477440 | + | 62 | NuclAT_22 | - | - |
- | 477379..477440 | + | 62 | NuclAT_25 | - | - |
- | 477379..477440 | + | 62 | NuclAT_25 | - | - |
- | 477379..477440 | + | 62 | NuclAT_25 | - | - |
- | 477379..477440 | + | 62 | NuclAT_25 | - | - |
- | 477379..477440 | + | 62 | NuclAT_28 | - | - |
- | 477379..477440 | + | 62 | NuclAT_28 | - | - |
- | 477379..477440 | + | 62 | NuclAT_28 | - | - |
- | 477379..477440 | + | 62 | NuclAT_28 | - | - |
- | 477379..477440 | + | 62 | NuclAT_31 | - | - |
- | 477379..477440 | + | 62 | NuclAT_31 | - | - |
- | 477379..477440 | + | 62 | NuclAT_31 | - | - |
- | 477379..477440 | + | 62 | NuclAT_31 | - | - |
- | 477379..477441 | + | 63 | NuclAT_46 | - | - |
- | 477379..477441 | + | 63 | NuclAT_46 | - | - |
- | 477379..477441 | + | 63 | NuclAT_46 | - | - |
- | 477379..477441 | + | 63 | NuclAT_46 | - | - |
- | 477379..477441 | + | 63 | NuclAT_49 | - | - |
- | 477379..477441 | + | 63 | NuclAT_49 | - | - |
- | 477379..477441 | + | 63 | NuclAT_49 | - | - |
- | 477379..477441 | + | 63 | NuclAT_49 | - | - |
- | 477379..477442 | + | 64 | NuclAT_34 | - | - |
- | 477379..477442 | + | 64 | NuclAT_34 | - | - |
- | 477379..477442 | + | 64 | NuclAT_34 | - | - |
- | 477379..477442 | + | 64 | NuclAT_34 | - | - |
- | 477379..477442 | + | 64 | NuclAT_36 | - | - |
- | 477379..477442 | + | 64 | NuclAT_36 | - | - |
- | 477379..477442 | + | 64 | NuclAT_36 | - | - |
- | 477379..477442 | + | 64 | NuclAT_36 | - | - |
- | 477379..477442 | + | 64 | NuclAT_38 | - | - |
- | 477379..477442 | + | 64 | NuclAT_38 | - | - |
- | 477379..477442 | + | 64 | NuclAT_38 | - | - |
- | 477379..477442 | + | 64 | NuclAT_38 | - | - |
- | 477379..477442 | + | 64 | NuclAT_40 | - | - |
- | 477379..477442 | + | 64 | NuclAT_40 | - | - |
- | 477379..477442 | + | 64 | NuclAT_40 | - | - |
- | 477379..477442 | + | 64 | NuclAT_40 | - | - |
- | 477379..477442 | + | 64 | NuclAT_42 | - | - |
- | 477379..477442 | + | 64 | NuclAT_42 | - | - |
- | 477379..477442 | + | 64 | NuclAT_42 | - | - |
- | 477379..477442 | + | 64 | NuclAT_42 | - | - |
- | 477379..477442 | + | 64 | NuclAT_44 | - | - |
- | 477379..477442 | + | 64 | NuclAT_44 | - | - |
- | 477379..477442 | + | 64 | NuclAT_44 | - | - |
- | 477379..477442 | + | 64 | NuclAT_44 | - | - |
GUU86_RS02360 | 477755..477862 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 477909..477975 | + | 67 | - | - | Antitoxin |
GUU86_RS02365 | 478267..479367 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
GUU86_RS02370 | 479637..479867 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
GUU86_RS02375 | 480025..480720 | + | 696 | WP_160183905.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
GUU86_RS02380 | 480764..481117 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
GUU86_RS02385 | 481302..482696 | + | 1395 | WP_000086201.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T147130 WP_000170965.1 NZ_CP047665:c477862-477755 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T147130 NZ_CP062868:902778-903185 [Escherichia coli]
GTGGTCCTGTGGCAATCTGATTTGCGCGTCTCCTGGCGCGCACAGTGGCTTTCCTTGCTGATTCATGGGCTGGTTGCCGC
TGTTATTTTACTCATGCCCTGGCCACTCAGTTACACCCCGTTATGGATGGTGTTACTTTCGCTGGTGGTGTTTGATTGCG
TTCGCAGCCAGCGGCGTATTAATGCTCGCCAGGGGGAAATTCGCTTGTTGATGGACGGGCGTTTGCGTTGGCAAGGGCAG
GAGTGGTGCATCGTCAAAGCACCGTGGATGATTAAGAGCGGCATGATGCTGCGTTTACGTTCTGATGGCGGTAAACGGCA
ACATTTATGGCTGGCAGCCGACAGCATGGACGAAGCCGAATGGCGGGATTTACGGCGGATTTTGTTGCAACAAGAGACGC
AAAGATAA
GTGGTCCTGTGGCAATCTGATTTGCGCGTCTCCTGGCGCGCACAGTGGCTTTCCTTGCTGATTCATGGGCTGGTTGCCGC
TGTTATTTTACTCATGCCCTGGCCACTCAGTTACACCCCGTTATGGATGGTGTTACTTTCGCTGGTGGTGTTTGATTGCG
TTCGCAGCCAGCGGCGTATTAATGCTCGCCAGGGGGAAATTCGCTTGTTGATGGACGGGCGTTTGCGTTGGCAAGGGCAG
GAGTGGTGCATCGTCAAAGCACCGTGGATGATTAAGAGCGGCATGATGCTGCGTTTACGTTCTGATGGCGGTAAACGGCA
ACATTTATGGCTGGCAGCCGACAGCATGGACGAAGCCGAATGGCGGGATTTACGGCGGATTTTGTTGCAACAAGAGACGC
AAAGATAA
Antitoxin
Download Length: 67 bp
>AT147130 NZ_CP047665:477909-477975 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|