Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 477755..477975 Replicon chromosome
Accession NZ_CP047665
Organism Escherichia coli strain LD26-1

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag GUU86_RS02360 Protein ID WP_000170965.1
Coordinates 477755..477862 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 477909..477975 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GUU86_RS02330 473610..474443 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
GUU86_RS02335 474440..474832 + 393 WP_089078767.1 invasion regulator SirB2 -
GUU86_RS02340 474836..475645 + 810 WP_001257044.1 invasion regulator SirB1 -
GUU86_RS02345 475681..476535 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
GUU86_RS02350 476684..476791 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 476839..476905 + 67 NuclAT_45 - -
- 476839..476905 + 67 NuclAT_45 - -
- 476839..476905 + 67 NuclAT_45 - -
- 476839..476905 + 67 NuclAT_45 - -
- 476839..476905 + 67 NuclAT_48 - -
- 476839..476905 + 67 NuclAT_48 - -
- 476839..476905 + 67 NuclAT_48 - -
- 476839..476905 + 67 NuclAT_48 - -
- 476841..476904 + 64 NuclAT_17 - -
- 476841..476904 + 64 NuclAT_17 - -
- 476841..476904 + 64 NuclAT_17 - -
- 476841..476904 + 64 NuclAT_17 - -
- 476841..476904 + 64 NuclAT_20 - -
- 476841..476904 + 64 NuclAT_20 - -
- 476841..476904 + 64 NuclAT_20 - -
- 476841..476904 + 64 NuclAT_20 - -
- 476841..476904 + 64 NuclAT_23 - -
- 476841..476904 + 64 NuclAT_23 - -
- 476841..476904 + 64 NuclAT_23 - -
- 476841..476904 + 64 NuclAT_23 - -
- 476841..476904 + 64 NuclAT_26 - -
- 476841..476904 + 64 NuclAT_26 - -
- 476841..476904 + 64 NuclAT_26 - -
- 476841..476904 + 64 NuclAT_26 - -
- 476841..476904 + 64 NuclAT_29 - -
- 476841..476904 + 64 NuclAT_29 - -
- 476841..476904 + 64 NuclAT_29 - -
- 476841..476904 + 64 NuclAT_29 - -
- 476841..476904 + 64 NuclAT_32 - -
- 476841..476904 + 64 NuclAT_32 - -
- 476841..476904 + 64 NuclAT_32 - -
- 476841..476904 + 64 NuclAT_32 - -
GUU86_RS02355 477219..477326 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 477379..477440 + 62 NuclAT_16 - -
- 477379..477440 + 62 NuclAT_16 - -
- 477379..477440 + 62 NuclAT_16 - -
- 477379..477440 + 62 NuclAT_16 - -
- 477379..477440 + 62 NuclAT_19 - -
- 477379..477440 + 62 NuclAT_19 - -
- 477379..477440 + 62 NuclAT_19 - -
- 477379..477440 + 62 NuclAT_19 - -
- 477379..477440 + 62 NuclAT_22 - -
- 477379..477440 + 62 NuclAT_22 - -
- 477379..477440 + 62 NuclAT_22 - -
- 477379..477440 + 62 NuclAT_22 - -
- 477379..477440 + 62 NuclAT_25 - -
- 477379..477440 + 62 NuclAT_25 - -
- 477379..477440 + 62 NuclAT_25 - -
- 477379..477440 + 62 NuclAT_25 - -
- 477379..477440 + 62 NuclAT_28 - -
- 477379..477440 + 62 NuclAT_28 - -
- 477379..477440 + 62 NuclAT_28 - -
- 477379..477440 + 62 NuclAT_28 - -
- 477379..477440 + 62 NuclAT_31 - -
- 477379..477440 + 62 NuclAT_31 - -
- 477379..477440 + 62 NuclAT_31 - -
- 477379..477440 + 62 NuclAT_31 - -
- 477379..477441 + 63 NuclAT_46 - -
- 477379..477441 + 63 NuclAT_46 - -
- 477379..477441 + 63 NuclAT_46 - -
- 477379..477441 + 63 NuclAT_46 - -
- 477379..477441 + 63 NuclAT_49 - -
- 477379..477441 + 63 NuclAT_49 - -
- 477379..477441 + 63 NuclAT_49 - -
- 477379..477441 + 63 NuclAT_49 - -
- 477379..477442 + 64 NuclAT_34 - -
- 477379..477442 + 64 NuclAT_34 - -
- 477379..477442 + 64 NuclAT_34 - -
- 477379..477442 + 64 NuclAT_34 - -
- 477379..477442 + 64 NuclAT_36 - -
- 477379..477442 + 64 NuclAT_36 - -
- 477379..477442 + 64 NuclAT_36 - -
- 477379..477442 + 64 NuclAT_36 - -
- 477379..477442 + 64 NuclAT_38 - -
- 477379..477442 + 64 NuclAT_38 - -
- 477379..477442 + 64 NuclAT_38 - -
- 477379..477442 + 64 NuclAT_38 - -
- 477379..477442 + 64 NuclAT_40 - -
- 477379..477442 + 64 NuclAT_40 - -
- 477379..477442 + 64 NuclAT_40 - -
- 477379..477442 + 64 NuclAT_40 - -
- 477379..477442 + 64 NuclAT_42 - -
- 477379..477442 + 64 NuclAT_42 - -
- 477379..477442 + 64 NuclAT_42 - -
- 477379..477442 + 64 NuclAT_42 - -
- 477379..477442 + 64 NuclAT_44 - -
- 477379..477442 + 64 NuclAT_44 - -
- 477379..477442 + 64 NuclAT_44 - -
- 477379..477442 + 64 NuclAT_44 - -
GUU86_RS02360 477755..477862 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 477909..477975 + 67 - - Antitoxin
GUU86_RS02365 478267..479367 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
GUU86_RS02370 479637..479867 + 231 WP_001146442.1 putative cation transport regulator ChaB -
GUU86_RS02375 480025..480720 + 696 WP_160183905.1 glutathione-specific gamma-glutamylcyclotransferase -
GUU86_RS02380 480764..481117 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
GUU86_RS02385 481302..482696 + 1395 WP_000086201.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T147130 WP_000170965.1 NZ_CP047665:c477862-477755 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T147130 NZ_CP062868:902778-903185 [Escherichia coli]
GTGGTCCTGTGGCAATCTGATTTGCGCGTCTCCTGGCGCGCACAGTGGCTTTCCTTGCTGATTCATGGGCTGGTTGCCGC
TGTTATTTTACTCATGCCCTGGCCACTCAGTTACACCCCGTTATGGATGGTGTTACTTTCGCTGGTGGTGTTTGATTGCG
TTCGCAGCCAGCGGCGTATTAATGCTCGCCAGGGGGAAATTCGCTTGTTGATGGACGGGCGTTTGCGTTGGCAAGGGCAG
GAGTGGTGCATCGTCAAAGCACCGTGGATGATTAAGAGCGGCATGATGCTGCGTTTACGTTCTGATGGCGGTAAACGGCA
ACATTTATGGCTGGCAGCCGACAGCATGGACGAAGCCGAATGGCGGGATTTACGGCGGATTTTGTTGCAACAAGAGACGC
AAAGATAA

Antitoxin


Download         Length: 67 bp

>AT147130 NZ_CP047665:477909-477975 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References