Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 47379..47648 | Replicon | plasmid p94EC-1 |
| Accession | NZ_CP047577 | ||
| Organism | Escherichia coli strain 94EC | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | GUJ28_RS23350 | Protein ID | WP_001312861.1 |
| Coordinates | 47490..47648 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 47379..47444 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GUJ28_RS23305 | 42440..43003 | + | 564 | WP_001311069.1 | class I SAM-dependent methyltransferase | - |
| GUJ28_RS23310 | 43155..43403 | + | 249 | WP_002433376.1 | hypothetical protein | - |
| GUJ28_RS23320 | 43876..44403 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| GUJ28_RS23325 | 44459..44692 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| GUJ28_RS23330 | 44751..46005 | + | 1255 | Protein_45 | ParB/RepB/Spo0J family partition protein | - |
| GUJ28_RS23335 | 46060..46494 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
| GUJ28_RS23340 | 46491..47210 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
| GUJ28_RS23345 | 47222..47410 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 47222..47446 | + | 225 | NuclAT_0 | - | - |
| - | 47222..47446 | + | 225 | NuclAT_0 | - | - |
| - | 47222..47446 | + | 225 | NuclAT_0 | - | - |
| - | 47222..47446 | + | 225 | NuclAT_0 | - | - |
| - | 47379..47444 | + | 66 | - | - | Antitoxin |
| GUJ28_RS23350 | 47490..47648 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| GUJ28_RS25600 | 48339..48545 | + | 207 | WP_000547939.1 | hypothetical protein | - |
| GUJ28_RS23360 | 48570..48857 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| GUJ28_RS23365 | 48978..49799 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| GUJ28_RS23370 | 50096..50698 | - | 603 | WP_000243709.1 | transglycosylase SLT domain-containing protein | - |
| GUJ28_RS23375 | 51019..51402 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| GUJ28_RS23380 | 51589..52278 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / sitABCD | iroN / iroE / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA | 1..178137 | 178137 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T146786 WP_001312861.1 NZ_CP047577:47490-47648 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T146786 NZ_CP062782:2354175-2354278 [Escherichia coli O157:H7]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTTTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTTTTTTT
Antitoxin
Download Length: 66 bp
>AT146786 NZ_CP047577:47379-47444 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|