Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 22424..22694 | Replicon | plasmid pMS6193B |
Accession | NZ_CP047407 | ||
Organism | Escherichia coli strain MS6193 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | MS6193_RS24800 | Protein ID | WP_001312861.1 |
Coordinates | 22536..22694 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 22424..22487 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MS6193_RS24760 | 17770..17958 | + | 189 | WP_032146593.1 | hypothetical protein | - |
MS6193_RS24765 | 17960..18166 | + | 207 | WP_000275858.1 | hypothetical protein | - |
MS6193_RS24770 | 18192..18731 | + | 540 | WP_001825195.1 | single-stranded DNA-binding protein | - |
MS6193_RS24775 | 18794..19027 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
MS6193_RS24780 | 19093..21051 | + | 1959 | WP_001825193.1 | ParB/RepB/Spo0J family partition protein | - |
MS6193_RS24785 | 21106..21540 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
MS6193_RS24790 | 21537..22256 | + | 720 | WP_013362833.1 | plasmid SOS inhibition protein A | - |
MS6193_RS24795 | 22268..22456 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 22268..22492 | + | 225 | NuclAT_0 | - | - |
- | 22268..22492 | + | 225 | NuclAT_0 | - | - |
- | 22268..22492 | + | 225 | NuclAT_0 | - | - |
- | 22268..22492 | + | 225 | NuclAT_0 | - | - |
- | 22424..22487 | - | 64 | - | - | Antitoxin |
MS6193_RS24800 | 22536..22694 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
MS6193_RS24805 | 23195..23383 | + | 189 | WP_042111937.1 | hypothetical protein | - |
MS6193_RS24810 | 23616..23903 | + | 288 | WP_000107544.1 | hypothetical protein | - |
MS6193_RS24815 | 24021..24842 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
MS6193_RS24820 | 25139..25786 | - | 648 | WP_031943493.1 | transglycosylase SLT domain-containing protein | - |
MS6193_RS24825 | 26063..26446 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
MS6193_RS24830 | 26637..27323 | + | 687 | WP_000332484.1 | PAS domain-containing protein | - |
MS6193_RS24835 | 27417..27644 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / rmtB | - | 1..76661 | 76661 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T146195 WP_001312861.1 NZ_CP047407:22536-22694 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T146195 NZ_CP062729:c3009211-3009056 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 64 bp
>AT146195 NZ_CP047407:c22487-22424 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|