Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 36781..37050 | Replicon | plasmid pCAU16175_3 |
Accession | NZ_CP047381 | ||
Organism | Escherichia coli strain CAU16175 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | GTP13_RS30710 | Protein ID | WP_001312861.1 |
Coordinates | 36892..37050 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 36781..36846 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTP13_RS30675 | 32081..32295 | - | 215 | Protein_41 | hypothetical protein | - |
GTP13_RS31225 | 32323..32529 | + | 207 | WP_112899861.1 | single-stranded DNA-binding protein | - |
GTP13_RS30680 | 32555..33082 | + | 528 | WP_000290816.1 | single-stranded DNA-binding protein | - |
GTP13_RS30685 | 33138..33371 | + | 234 | WP_000005971.1 | DUF905 domain-containing protein | - |
GTP13_RS30690 | 33435..35393 | + | 1959 | Protein_45 | ParB/RepB/Spo0J family partition protein | - |
GTP13_RS30695 | 35462..35896 | + | 435 | WP_001623019.1 | conjugation system SOS inhibitor PsiB | - |
GTP13_RS30700 | 35893..36612 | + | 720 | WP_001629131.1 | plasmid SOS inhibition protein A | - |
GTP13_RS30705 | 36624..36812 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 36624..36848 | + | 225 | NuclAT_0 | - | - |
- | 36624..36848 | + | 225 | NuclAT_0 | - | - |
- | 36624..36848 | + | 225 | NuclAT_0 | - | - |
- | 36624..36848 | + | 225 | NuclAT_0 | - | - |
- | 36781..36846 | + | 66 | - | - | Antitoxin |
GTP13_RS30710 | 36892..37050 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
GTP13_RS31230 | 37741..37947 | + | 207 | WP_000547971.1 | hypothetical protein | - |
GTP13_RS30720 | 37972..38259 | + | 288 | WP_000107535.1 | hypothetical protein | - |
GTP13_RS30725 | 38377..39198 | + | 822 | WP_137509722.1 | DUF945 domain-containing protein | - |
GTP13_RS30730 | 39495..40142 | - | 648 | WP_000614935.1 | transglycosylase SLT domain-containing protein | - |
GTP13_RS30735 | 40419..40802 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
GTP13_RS30740 | 40993..41679 | + | 687 | WP_073520017.1 | PAS domain-containing protein | - |
GTP13_RS30745 | 41773..42000 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mcr-1.1 / blaTEM-1B / tet(M) | - | 1..76633 | 76633 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T146119 WP_001312861.1 NZ_CP047381:36892-37050 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T146119 NZ_CP062723:4480571-4480831 [Escherichia coli O157:H7]
TTGAACTCGGGACAATTTTCAAAGGATGTAAAACTTGCACAAAAGCGTCATAAGGATATGAATAAATTGAAATATCTTAT
GACGCTTCTTATCAATAATACTTTACCGCTTCCAGCTGTTTATAAAGACCACCCGCTGCAAGGTTCATGGAAAGGTTATC
GCGATGCTCATGTCGAACCGGACTGGATCCTGATTTACAAACTTACCGATAAACTTTTACGATTTGAGAGAACTGGAACT
CACGCGGCGCTCTTTGGGTAA
TTGAACTCGGGACAATTTTCAAAGGATGTAAAACTTGCACAAAAGCGTCATAAGGATATGAATAAATTGAAATATCTTAT
GACGCTTCTTATCAATAATACTTTACCGCTTCCAGCTGTTTATAAAGACCACCCGCTGCAAGGTTCATGGAAAGGTTATC
GCGATGCTCATGTCGAACCGGACTGGATCCTGATTTACAAACTTACCGATAAACTTTTACGATTTGAGAGAACTGGAACT
CACGCGGCGCTCTTTGGGTAA
Antitoxin
Download Length: 66 bp
>AT146119 NZ_CP047381:36781-36846 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|