Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 31273..31619 | Replicon | plasmid pCAU16175_3 |
Accession | NZ_CP047381 | ||
Organism | Escherichia coli strain CAU16175 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | GTP13_RS30670 | Protein ID | WP_012817833.1 |
Coordinates | 31461..31619 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 31273..31409 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTP13_RS30640 | 26702..27235 | + | 534 | WP_053913426.1 | single-stranded DNA-binding protein | - |
GTP13_RS30645 | 27293..27526 | + | 234 | WP_053913425.1 | DUF905 family protein | - |
GTP13_RS30650 | 27590..29548 | + | 1959 | WP_167583057.1 | ParB/RepB/Spo0J family partition protein | - |
GTP13_RS30655 | 29617..30051 | + | 435 | WP_000845930.1 | conjugation system SOS inhibitor PsiB | - |
GTP13_RS30660 | 30048..30767 | + | 720 | WP_053913421.1 | plasmid SOS inhibition protein A | - |
GTP13_RS30665 | 30767..31285 | + | 519 | WP_112899860.1 | hypothetical protein | - |
- | 31261..31409 | + | 149 | NuclAT_1 | - | - |
- | 31261..31409 | + | 149 | NuclAT_1 | - | - |
- | 31261..31409 | + | 149 | NuclAT_1 | - | - |
- | 31261..31409 | + | 149 | NuclAT_1 | - | - |
- | 31273..31409 | - | 137 | - | - | Antitoxin |
GTP13_RS30670 | 31461..31619 | + | 159 | WP_012817833.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
GTP13_RS30675 | 32081..32295 | - | 215 | Protein_41 | hypothetical protein | - |
GTP13_RS31225 | 32323..32529 | + | 207 | WP_112899861.1 | single-stranded DNA-binding protein | - |
GTP13_RS30680 | 32555..33082 | + | 528 | WP_000290816.1 | single-stranded DNA-binding protein | - |
GTP13_RS30685 | 33138..33371 | + | 234 | WP_000005971.1 | DUF905 domain-containing protein | - |
GTP13_RS30690 | 33435..35393 | + | 1959 | Protein_45 | ParB/RepB/Spo0J family partition protein | - |
GTP13_RS30695 | 35462..35896 | + | 435 | WP_001623019.1 | conjugation system SOS inhibitor PsiB | - |
GTP13_RS30700 | 35893..36612 | + | 720 | WP_001629131.1 | plasmid SOS inhibition protein A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mcr-1.1 / blaTEM-1B / tet(M) | - | 1..76633 | 76633 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6078.30 Da Isoelectric Point: 8.7390
>T146117 WP_012817833.1 NZ_CP047381:31461-31619 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLMFTYLTRKSLCEIRYRDGDREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLMFTYLTRKSLCEIRYRDGDREVAAFMAYESGK
Download Length: 159 bp
>T146117 NZ_CP062723:4215909-4216127 [Escherichia coli O157:H7]
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA
Antitoxin
Download Length: 137 bp
>AT146117 NZ_CP047381:c31409-31273 [Escherichia coli]
AGACATATGGGATGCCTCGTGGGTTAATGAAAAATTAACTACGGGGCTATCTTCTTTCTGCCACACAACACGGTAACAAA
CCACCTTCACGTCATGAGGCAGAAAGCCTCAAGCGCCGGGCACATCATAGCCCATAT
AGACATATGGGATGCCTCGTGGGTTAATGAAAAATTAACTACGGGGCTATCTTCTTTCTGCCACACAACACGGTAACAAA
CCACCTTCACGTCATGAGGCAGAAAGCCTCAAGCGCCGGGCACATCATAGCCCATAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|