145969

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2003434..2003848 Replicon chromosome
Accession NZ_CP047321
Organism Staphylococcus aureus strain RJ1267

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag GSF72_RS10085 Protein ID WP_048669304.1
Coordinates 2003597..2003848 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag GSF72_RS14825 Protein ID WP_000028424.1
Coordinates 2003434..2003607 (-) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GSF72_RS10040 1998675..2000336 - 1662 WP_000625088.1 terminase large subunit -
GSF72_RS10045 2000333..2000677 - 345 WP_000402904.1 hypothetical protein -
GSF72_RS10050 2000807..2001106 - 300 WP_000988336.1 HNH endonuclease -
GSF72_RS10055 2001338..2001754 - 417 WP_000590122.1 hypothetical protein -
GSF72_RS10060 2001782..2001982 - 201 WP_000265041.1 DUF1514 family protein -
GSF72_RS10065 2001982..2002197 - 216 WP_048665701.1 hypothetical protein -
GSF72_RS10070 2002190..2002426 - 237 WP_000483477.1 hypothetical protein -
GSF72_RS10075 2002451..2002687 - 237 WP_000195831.1 DUF1381 domain-containing protein -
GSF72_RS10080 2002724..2003257 - 534 WP_031807824.1 dUTPase -
GSF72_RS14820 2003272..2003433 - 162 WP_000889682.1 hypothetical protein -
GSF72_RS14825 2003434..2003607 - 174 WP_000028424.1 hypothetical protein Antitoxin
GSF72_RS10085 2003597..2003848 - 252 WP_048669304.1 DUF1024 family protein Toxin
GSF72_RS10090 2003841..2004092 - 252 Protein_1945 hypothetical protein -
GSF72_RS10095 2004098..2004559 - 462 WP_048665699.1 hypothetical protein -
GSF72_RS10100 2004556..2004750 - 195 WP_048665698.1 hypothetical protein -
GSF72_RS10105 2004747..2005151 - 405 WP_000695764.1 hypothetical protein -
GSF72_RS10110 2005165..2005413 - 249 WP_000178883.1 phi PVL orf 51-like protein -
GSF72_RS10115 2005422..2005622 - 201 WP_000235323.1 hypothetical protein -
GSF72_RS10120 2005625..2005882 - 258 WP_000022739.1 DUF3310 domain-containing protein -
GSF72_RS10125 2005882..2006253 - 372 WP_000241093.1 hypothetical protein -
GSF72_RS10130 2006254..2006439 - 186 WP_029625657.1 DUF3113 family protein -
GSF72_RS10135 2006444..2006848 - 405 WP_000049789.1 DUF1064 domain-containing protein -
GSF72_RS10140 2006859..2007080 - 222 WP_001123695.1 DUF3269 family protein -
GSF72_RS10145 2007093..2007251 - 159 WP_031942166.1 hypothetical protein -
GSF72_RS10150 2007248..2008033 - 786 WP_031942165.1 ATP-binding protein -
GSF72_RS10155 2008046..2008777 - 732 WP_159343897.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1978458..2020333 41875


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9404.38 Da        Isoelectric Point: 3.8364

>T145969 WP_048669304.1 NZ_CP047321:c2003848-2003597 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILKGLPNAMQDALKEDIELDEAIGIMTGQVVYKYEEAQE
NEY

Download         Length: 252 bp

>T145969 NZ_CP062713:c3586177-3586022 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT145969 WP_000028424.1 NZ_CP047321:c2003607-2003434 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp

>AT145969 NZ_CP062713:3586189-3586247 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References