Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 993553..993735 | Replicon | chromosome |
Accession | NZ_CP047321 | ||
Organism | Staphylococcus aureus strain RJ1267 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | GSF72_RS05185 | Protein ID | WP_001801861.1 |
Coordinates | 993640..993735 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 993553..993612 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GSF72_RS05145 | 988553..988747 | - | 195 | Protein_964 | IS3 family transposase | - |
GSF72_RS05150 | 989016..990011 | - | 996 | WP_046464740.1 | putative sulfate exporter family transporter | - |
GSF72_RS05155 | 990126..990947 | + | 822 | WP_000371597.1 | LysR family transcriptional regulator | - |
GSF72_RS05160 | 991085..991789 | + | 705 | WP_048665789.1 | helix-turn-helix domain-containing protein | - |
GSF72_RS05165 | 991708..992637 | + | 930 | WP_117206203.1 | IS3 family transposase | - |
GSF72_RS05170 | 992865..993068 | + | 204 | Protein_969 | DUF1433 domain-containing protein | - |
GSF72_RS05175 | 993262..993438 | + | 177 | Protein_970 | transposase | - |
GSF72_RS05180 | 993416..993517 | - | 102 | WP_001791893.1 | hypothetical protein | - |
- | 993553..993612 | + | 60 | - | - | Antitoxin |
GSF72_RS05185 | 993640..993735 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
GSF72_RS05190 | 993938..994081 | + | 144 | WP_001549059.1 | transposase | - |
GSF72_RS05195 | 994685..995068 | + | 384 | WP_000070812.1 | hypothetical protein | - |
GSF72_RS05200 | 995079..995255 | + | 177 | WP_000375476.1 | hypothetical protein | - |
GSF72_RS05205 | 995257..995442 | + | 186 | WP_000809857.1 | hypothetical protein | - |
GSF72_RS05210 | 995556..996197 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
GSF72_RS05215 | 996415..996966 | - | 552 | WP_000414205.1 | hypothetical protein | - |
GSF72_RS05220 | 997064..997408 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
GSF72_RS05225 | 997449..998075 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | fusB | - | 963141..1031175 | 68034 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T145963 WP_001801861.1 NZ_CP047321:c993735-993640 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T145963 NZ_CP062713:2693593-2693748 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 60 bp
>AT145963 NZ_CP047321:993553-993612 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|