Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 132030..132283 | Replicon | plasmid unnamed2 |
Accession | NZ_CP047194 | ||
Organism | Klebsiella pneumoniae strain Kp36 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | GS419_RS28930 | Protein ID | WP_001312851.1 |
Coordinates | 132030..132179 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 132224..132283 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GS419_RS28895 | 127389..127804 | - | 416 | Protein_167 | IS1 family transposase | - |
GS419_RS28900 | 128053..128454 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
GS419_RS28905 | 128387..128644 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
GS419_RS28910 | 128737..129390 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
GS419_RS28915 | 130329..131186 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
GS419_RS28920 | 131179..131253 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
GS419_RS28925 | 131498..131746 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
GS419_RS28930 | 132030..132179 | - | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 132224..132283 | + | 60 | NuclAT_1 | - | Antitoxin |
- | 132224..132283 | + | 60 | NuclAT_1 | - | Antitoxin |
- | 132224..132283 | + | 60 | NuclAT_1 | - | Antitoxin |
- | 132224..132283 | + | 60 | NuclAT_1 | - | Antitoxin |
GS419_RS28935 | 132484..132714 | - | 231 | WP_001736714.1 | hypothetical protein | - |
GS419_RS28940 | 132878..133477 | - | 600 | WP_032083981.1 | hypothetical protein | - |
GS419_RS28945 | 133863..134063 | - | 201 | WP_015059022.1 | hypothetical protein | - |
GS419_RS28950 | 134195..134755 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
GS419_RS28955 | 134810..135556 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
GS419_RS28960 | 135576..135737 | - | 162 | Protein_180 | DNA helicase | - |
GS419_RS28965 | 135801..136505 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaKPC-2 / blaSHV-12 / rmtB / blaTEM-1B / fosA3 / blaCTX-M-65 | - | 1..142228 | 142228 | |
- | flank | IS/Tn | - | - | 135801..136505 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T145564 WP_001312851.1 NZ_CP047194:c132179-132030 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T145564 NZ_CP062405:c2204217-2204110 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 60 bp
>AT145564 NZ_CP047194:132224-132283 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|