Detailed information of TA system TA145343

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/-
• Location: 2047396..2047810
• Replicon: chromosome
• Accession: NZ_CP047021
• Organism: Staphylococcus aureus strain M2024

Toxin (Protein)

• Gene name: higB
• Uniprot ID: -
• Locus tag: GQX63_RS10100
• Protein ID: WP_025174939.1
• Coordinates: 2047559..2047810 (-)
• Length: 84 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: GQX63_RS10095
• Protein ID: WP_000028424.1
• Coordinates: 2047396..2047569 (-)
• Length: 58 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
GQX63_RS10035	2043444..2043911	-	468	WP_000919026.1	phage terminase small subunit P27 family	-
GQX63_RS10040	2044040..2044384	-	345	WP_000817289.1	HNH endonuclease	-
GQX63_RS10045	2044400..2044852	-	453	WP_000406191.1	nucleoside triphosphate pyrophosphohydrolase family protein	-
GQX63_RS10050	2044967..2045428	-	462	WP_000282756.1	hypothetical protein	-
GQX63_RS10055	2045451..2045651	-	201	WP_001570807.1	DUF1514 family protein	-
GQX63_RS10060	2045651..2045776	-	126	WP_031783376.1	transcriptional regulator	-
GQX63_RS10065	2045769..2045972	-	204	WP_001072793.1	hypothetical protein	-
GQX63_RS10070	2045973..2046164	-	192	Protein_1940	hypothetical protein	-
GQX63_RS10075	2046161..2046367	-	207	WP_000195826.1	DUF1381 domain-containing protein	-
GQX63_RS10080	2046404..2046937	-	534	WP_025920701.1	dUTP diphosphatase	-
GQX63_RS10085	2046952..2047113	-	162	WP_000889683.1	hypothetical protein	-
GQX63_RS10090	2047114..2047395	-	282	WP_000454994.1	hypothetical protein	-
GQX63_RS10095	2047396..2047569	-	174	WP_000028424.1	hypothetical protein	Antitoxin
GQX63_RS10100	2047559..2047810	-	252	WP_025174939.1	DUF1024 family protein	Toxin
GQX63_RS10105	2047825..2048067	-	243	WP_000131381.1	phi PVL orf 51-like protein	-
GQX63_RS10110	2048071..2048441	-	371	Protein_1948	hypothetical protein	-
GQX63_RS10115	2048454..2048858	-	405	WP_000401978.1	RusA family crossover junction endodeoxyribonuclease	-
GQX63_RS10120	2048867..2049085	-	219	WP_000338527.1	hypothetical protein	-
GQX63_RS10125	2049092..2049985	-	894	WP_000148335.1	DnaD domain-containing protein	-
GQX63_RS10130	2050015..2050485	-	471	WP_000934760.1	single-stranded DNA-binding protein	-
GQX63_RS10135	2050486..2051103	-	618	WP_071621397.1	MBL fold metallo-hydrolase	-
GQX63_RS10140	2051184..2052104	-	921	WP_000138475.1	recombinase RecT	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	scn / sak / sea / hlb / groEL	2019010..2075692	56682

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Protein of unknown function DUF1024 (1-82)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 84 a.a.
• Molecular weight: 9361.22 Da
• Isoelectric Point: 3.8464

>T145343 WP_025174939.1 NZ_CP047021:c2047810-2047559 [Staphylococcus aureus]
MNNREQIEQSIISASAYNGNDTEGLLKEVEDVYKKAQAFDEILDGMTNAIQHSVKEGVELDEAVGIMAGQVVYKYEEEQE
NEY

Nucleotide

• Length: 252 bp

>T145343 NZ_CP062360:c2429306-2429199 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA

Antitoxin

Protein

• Length: 58 a.a.
• Molecular weight: 6468.29 Da
• Isoelectric Point: 4.2484

>AT145343 WP_000028424.1 NZ_CP047021:c2047569-2047396 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Nucleotide

• Length: 174 bp

>AT145343 NZ_CP062360:2429122-2429182 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA