Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1808929..1809151 Replicon chromosome
Accession NZ_CP047010
Organism Escherichia coli strain 19-5

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag GQF95_RS08805 Protein ID WP_000170965.1
Coordinates 1808929..1809036 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1809084..1809151 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GQF95_RS08775 (1804787) 1804787..1805620 + 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
GQF95_RS08780 (1805617) 1805617..1806009 + 393 WP_063502054.1 invasion regulator SirB2 -
GQF95_RS08785 (1806013) 1806013..1806822 + 810 WP_001257044.1 invasion regulator SirB1 -
GQF95_RS08790 (1806858) 1806858..1807712 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
GQF95_RS08795 (1807859) 1807859..1807966 - 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1808014) 1808014..1808080 + 67 NuclAT_31 - -
- (1808014) 1808014..1808080 + 67 NuclAT_31 - -
- (1808014) 1808014..1808080 + 67 NuclAT_31 - -
- (1808014) 1808014..1808080 + 67 NuclAT_31 - -
- (1808014) 1808014..1808080 + 67 NuclAT_33 - -
- (1808014) 1808014..1808080 + 67 NuclAT_33 - -
- (1808014) 1808014..1808080 + 67 NuclAT_33 - -
- (1808014) 1808014..1808080 + 67 NuclAT_33 - -
- (1808014) 1808014..1808080 + 67 NuclAT_35 - -
- (1808014) 1808014..1808080 + 67 NuclAT_35 - -
- (1808014) 1808014..1808080 + 67 NuclAT_35 - -
- (1808014) 1808014..1808080 + 67 NuclAT_35 - -
- (1808014) 1808014..1808080 + 67 NuclAT_37 - -
- (1808014) 1808014..1808080 + 67 NuclAT_37 - -
- (1808014) 1808014..1808080 + 67 NuclAT_37 - -
- (1808014) 1808014..1808080 + 67 NuclAT_37 - -
- (1808014) 1808014..1808080 + 67 NuclAT_39 - -
- (1808014) 1808014..1808080 + 67 NuclAT_39 - -
- (1808014) 1808014..1808080 + 67 NuclAT_39 - -
- (1808014) 1808014..1808080 + 67 NuclAT_39 - -
- (1808014) 1808014..1808080 + 67 NuclAT_41 - -
- (1808014) 1808014..1808080 + 67 NuclAT_41 - -
- (1808014) 1808014..1808080 + 67 NuclAT_41 - -
- (1808014) 1808014..1808080 + 67 NuclAT_41 - -
- (1808016) 1808016..1808081 + 66 NuclAT_15 - -
- (1808016) 1808016..1808081 + 66 NuclAT_15 - -
- (1808016) 1808016..1808081 + 66 NuclAT_15 - -
- (1808016) 1808016..1808081 + 66 NuclAT_15 - -
- (1808016) 1808016..1808081 + 66 NuclAT_18 - -
- (1808016) 1808016..1808081 + 66 NuclAT_18 - -
- (1808016) 1808016..1808081 + 66 NuclAT_18 - -
- (1808016) 1808016..1808081 + 66 NuclAT_18 - -
- (1808016) 1808016..1808081 + 66 NuclAT_21 - -
- (1808016) 1808016..1808081 + 66 NuclAT_21 - -
- (1808016) 1808016..1808081 + 66 NuclAT_21 - -
- (1808016) 1808016..1808081 + 66 NuclAT_21 - -
- (1808016) 1808016..1808081 + 66 NuclAT_24 - -
- (1808016) 1808016..1808081 + 66 NuclAT_24 - -
- (1808016) 1808016..1808081 + 66 NuclAT_24 - -
- (1808016) 1808016..1808081 + 66 NuclAT_24 - -
- (1808016) 1808016..1808081 + 66 NuclAT_27 - -
- (1808016) 1808016..1808081 + 66 NuclAT_27 - -
- (1808016) 1808016..1808081 + 66 NuclAT_27 - -
- (1808016) 1808016..1808081 + 66 NuclAT_27 - -
- (1808016) 1808016..1808081 + 66 NuclAT_30 - -
- (1808016) 1808016..1808081 + 66 NuclAT_30 - -
- (1808016) 1808016..1808081 + 66 NuclAT_30 - -
- (1808016) 1808016..1808081 + 66 NuclAT_30 - -
GQF95_RS08800 (1808394) 1808394..1808501 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1808550) 1808550..1808615 + 66 NuclAT_32 - -
- (1808550) 1808550..1808615 + 66 NuclAT_32 - -
- (1808550) 1808550..1808615 + 66 NuclAT_32 - -
- (1808550) 1808550..1808615 + 66 NuclAT_32 - -
- (1808550) 1808550..1808615 + 66 NuclAT_34 - -
- (1808550) 1808550..1808615 + 66 NuclAT_34 - -
- (1808550) 1808550..1808615 + 66 NuclAT_34 - -
- (1808550) 1808550..1808615 + 66 NuclAT_34 - -
- (1808550) 1808550..1808615 + 66 NuclAT_36 - -
- (1808550) 1808550..1808615 + 66 NuclAT_36 - -
- (1808550) 1808550..1808615 + 66 NuclAT_36 - -
- (1808550) 1808550..1808615 + 66 NuclAT_36 - -
- (1808550) 1808550..1808615 + 66 NuclAT_38 - -
- (1808550) 1808550..1808615 + 66 NuclAT_38 - -
- (1808550) 1808550..1808615 + 66 NuclAT_38 - -
- (1808550) 1808550..1808615 + 66 NuclAT_38 - -
- (1808550) 1808550..1808615 + 66 NuclAT_40 - -
- (1808550) 1808550..1808615 + 66 NuclAT_40 - -
- (1808550) 1808550..1808615 + 66 NuclAT_40 - -
- (1808550) 1808550..1808615 + 66 NuclAT_40 - -
- (1808550) 1808550..1808615 + 66 NuclAT_42 - -
- (1808550) 1808550..1808615 + 66 NuclAT_42 - -
- (1808550) 1808550..1808615 + 66 NuclAT_42 - -
- (1808550) 1808550..1808615 + 66 NuclAT_42 - -
- (1808549) 1808549..1808616 + 68 NuclAT_14 - -
- (1808549) 1808549..1808616 + 68 NuclAT_14 - -
- (1808549) 1808549..1808616 + 68 NuclAT_14 - -
- (1808549) 1808549..1808616 + 68 NuclAT_14 - -
- (1808549) 1808549..1808616 + 68 NuclAT_17 - -
- (1808549) 1808549..1808616 + 68 NuclAT_17 - -
- (1808549) 1808549..1808616 + 68 NuclAT_17 - -
- (1808549) 1808549..1808616 + 68 NuclAT_17 - -
- (1808549) 1808549..1808616 + 68 NuclAT_20 - -
- (1808549) 1808549..1808616 + 68 NuclAT_20 - -
- (1808549) 1808549..1808616 + 68 NuclAT_20 - -
- (1808549) 1808549..1808616 + 68 NuclAT_20 - -
- (1808549) 1808549..1808616 + 68 NuclAT_23 - -
- (1808549) 1808549..1808616 + 68 NuclAT_23 - -
- (1808549) 1808549..1808616 + 68 NuclAT_23 - -
- (1808549) 1808549..1808616 + 68 NuclAT_23 - -
- (1808549) 1808549..1808616 + 68 NuclAT_26 - -
- (1808549) 1808549..1808616 + 68 NuclAT_26 - -
- (1808549) 1808549..1808616 + 68 NuclAT_26 - -
- (1808549) 1808549..1808616 + 68 NuclAT_26 - -
- (1808549) 1808549..1808616 + 68 NuclAT_29 - -
- (1808549) 1808549..1808616 + 68 NuclAT_29 - -
- (1808549) 1808549..1808616 + 68 NuclAT_29 - -
- (1808549) 1808549..1808616 + 68 NuclAT_29 - -
GQF95_RS08805 (1808929) 1808929..1809036 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1809084) 1809084..1809151 + 68 NuclAT_13 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_13 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_13 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_13 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_16 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_16 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_16 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_16 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_19 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_19 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_19 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_19 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_22 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_22 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_22 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_22 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_25 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_25 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_25 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_25 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_28 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_28 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_28 - Antitoxin
- (1809084) 1809084..1809151 + 68 NuclAT_28 - Antitoxin
GQF95_RS08810 (1809441) 1809441..1810541 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
GQF95_RS08815 (1810811) 1810811..1811041 + 231 WP_001146444.1 putative cation transport regulator ChaB -
GQF95_RS08820 (1811199) 1811199..1811894 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
GQF95_RS08825 (1811938) 1811938..1812291 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
GQF95_RS08830 (1812477) 1812477..1813871 + 1395 WP_063502011.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T145295 WP_000170965.1 NZ_CP047010:c1809036-1808929 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T145295 NZ_CP062352:c173304-173209 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG

Antitoxin


Download         Length: 68 bp

>AT145295 NZ_CP047010:1809084-1809151 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References