Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 16280..16534 Replicon plasmid pTEM
Accession NZ_CP047003
Organism Escherichia coli strain J-8

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag GQF94_RS23075 Protein ID WP_001312851.1
Coordinates 16385..16534 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 16280..16341 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GQF94_RS23050 (11390) 11390..11658 - 269 Protein_11 integrase core domain-containing protein -
GQF94_RS23055 (11715) 11715..12412 + 698 WP_224158172.1 IS1-like element IS1A family transposase -
GQF94_RS23060 (12490) 12490..13879 - 1390 Protein_13 ISNCY family transposase -
GQF94_RS23065 (13967) 13967..14671 + 705 WP_001067858.1 IS6-like element IS26 family transposase -
GQF94_RS23070 (14723) 14723..15918 - 1196 Protein_15 IS21-like element ISEc12 family transposase -
- (16280) 16280..16341 - 62 NuclAT_1 - Antitoxin
- (16280) 16280..16341 - 62 NuclAT_1 - Antitoxin
- (16280) 16280..16341 - 62 NuclAT_1 - Antitoxin
- (16280) 16280..16341 - 62 NuclAT_1 - Antitoxin
GQF94_RS23075 (16385) 16385..16534 + 150 WP_001312851.1 Hok/Gef family protein Toxin
GQF94_RS23080 (16818) 16818..17075 + 258 WP_000083845.1 replication regulatory protein RepA -
GQF94_RS25430 (17092) 17092..17343 - 252 WP_223195197.1 replication protein RepA -
GQF94_RS25435 (17334) 17334..17381 + 48 WP_229471593.1 hypothetical protein -
GQF94_RS23090 (17374) 17374..17856 + 483 WP_001273588.1 hypothetical protein -
GQF94_RS23095 (17849) 17849..18706 + 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
GQF94_RS23100 (19648) 19648..20301 + 654 WP_064055666.1 CPBP family intramembrane metalloprotease -
GQF94_RS23105 (20394) 20394..20651 + 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
GQF94_RS23110 (20584) 20584..20985 + 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1B / oqxA / oqxB / dfrA12 / aadA2 / aph(3')-Ia / mph(A) / aac(3)-IId / sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..116304 116304


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T145278 WP_001312851.1 NZ_CP047003:16385-16534 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T145278 NZ_CP062348:c1930134-1930030 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA

Antitoxin


Download         Length: 62 bp

>AT145278 NZ_CP047003:c16341-16280 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References