Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-MqsA
Location 2411403..2412036 Replicon chromosome
Accession NZ_CP046785
Organism Vibrio parahaemolyticus strain 2013V-1136

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag GPY45_RS12050 Protein ID WP_089202945.1
Coordinates 2411403..2411735 (+) Length 111 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag GPY45_RS12055 Protein ID WP_089202944.1
Coordinates 2411722..2412036 (+) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GPY45_RS11980 2406478..2407143 + 666 WP_089202955.1 hypothetical protein -
GPY45_RS11985 2407164..2407256 + 93 WP_089202954.1 DUF3265 domain-containing protein -
GPY45_RS11990 2407306..2407947 + 642 WP_089202953.1 hypothetical protein -
GPY45_RS11995 2407967..2408059 + 93 WP_072612521.1 DUF3265 domain-containing protein -
GPY45_RS12000 2408067..2408384 - 318 WP_053300098.1 CcdB family protein -
GPY45_RS12005 2408384..2408629 - 246 WP_089202951.1 type II toxin-antitoxin system CcdA family antitoxin -
GPY45_RS12010 2408704..2408796 + 93 WP_089202950.1 DUF3265 domain-containing protein -
GPY45_RS12020 2409308..2409742 + 435 WP_141106041.1 hypothetical protein -
GPY45_RS12025 2409998..2410201 + 204 WP_190970714.1 hypothetical protein -
GPY45_RS12030 2410369..2410458 + 90 WP_079854229.1 DUF3265 domain-containing protein -
GPY45_RS12035 2410561..2410893 + 333 WP_012600340.1 type II toxin-antitoxin system RelE/ParE family toxin -
GPY45_RS12040 2410880..2411194 + 315 WP_017049537.1 DNA-binding transcriptional regulator -
GPY45_RS12045 2411209..2411301 + 93 WP_089202946.1 DUF3265 domain-containing protein -
GPY45_RS12050 2411403..2411735 + 333 WP_089202945.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
GPY45_RS12055 2411722..2412036 + 315 WP_089202944.1 DNA-binding transcriptional regulator Antitoxin
GPY45_RS12060 2412171..2412962 + 792 WP_089202943.1 hypothetical protein -
GPY45_RS12065 2412977..2413069 + 93 WP_089202942.1 DUF3265 domain-containing protein -
GPY45_RS12070 2413096..2413620 + 525 WP_089202941.1 GNAT family N-acetyltransferase -
GPY45_RS12075 2413744..2414496 + 753 WP_031828262.1 DUF2971 domain-containing protein -
GPY45_RS12080 2414511..2414603 + 93 WP_079720270.1 DUF3265 domain-containing protein -
GPY45_RS12085 2414643..2415188 + 546 WP_089202940.1 GNAT family N-acetyltransferase -
GPY45_RS12090 2415343..2415702 + 360 WP_089202939.1 VOC family protein -
GPY45_RS25400 2416216..2416359 + 144 WP_195839691.1 DUF3265 domain-containing protein -
GPY45_RS12100 2416461..2416670 + 210 WP_025506672.1 DUF3955 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - vpadF / vpadF / vxsC / virG / exsA / exsD / vscB / vscC / vscD / vscF / vscG / vscH / vscI / vscJ / vscK / vscL / vopS / vopR / vecA / vopQ / vscU / vscT / vscS / vscR / vscQ / vscP / vscO / vscN / vopN / tyeA/vcr1 / sycN/vcr2 / vscX / vscY / vcrD / vcrR / vcrG / vcrV / vcrH / vopB / vopD / VP1611 2322112..2711902 389790
- inside Integron - - 2397971..2490093 92122


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(4-104)

Antitoxin

Cro/C1-type helix-turn-helix domain

(43-92)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12920.78 Da        Isoelectric Point: 10.0960

>T144935 WP_089202945.1 NZ_CP046785:2411403-2411735 [Vibrio parahaemolyticus]
MKSVFVESTIFEKYRNEYLSDEEFRLFQAELMSNPKQGDVIQGTGGLRKIRVASKGKGKRGGSRVIYYFLDEKRRFYLLT
IYGKNEMSDLTADQKKQLKAFMEAWRNEQS

Download         Length: 333 bp

>T144935 NZ_CP062246:c3693447-3693340 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 11704.17 Da        Isoelectric Point: 6.3290

>AT144935 WP_089202944.1 NZ_CP046785:2411722-2412036 [Vibrio parahaemolyticus]
MSNRDLFAELSSALVEAKEHSEGKVTLKTHQINDISELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSAP
NGQAVTLLKLVQRHPETLSHIAEL

Download         Length: 315 bp

>AT144935 NZ_CP062246:3693496-3693562 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References