Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4253037..4253251 Replicon chromosome
Accession NZ_CP046527
Organism Escherichia coli strain RM19259

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag GN312_RS21175 Protein ID WP_000170963.1
Coordinates 4253037..4253144 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4253192..4253251 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GN312_RS21145 4248346..4249428 + 1083 WP_000804726.1 peptide chain release factor 1 -
GN312_RS21150 4249428..4250261 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
GN312_RS21155 4250258..4250650 + 393 WP_000200379.1 invasion regulator SirB2 -
GN312_RS21160 4250654..4251463 + 810 WP_001257044.1 invasion regulator SirB1 -
GN312_RS21165 4251499..4252353 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
GN312_RS21170 4252501..4252608 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4252661..4252722 + 62 NuclAT_24 - -
- 4252661..4252722 + 62 NuclAT_24 - -
- 4252661..4252722 + 62 NuclAT_24 - -
- 4252661..4252722 + 62 NuclAT_24 - -
- 4252661..4252722 + 62 NuclAT_26 - -
- 4252661..4252722 + 62 NuclAT_26 - -
- 4252661..4252722 + 62 NuclAT_26 - -
- 4252661..4252722 + 62 NuclAT_26 - -
- 4252661..4252722 + 62 NuclAT_28 - -
- 4252661..4252722 + 62 NuclAT_28 - -
- 4252661..4252722 + 62 NuclAT_28 - -
- 4252661..4252722 + 62 NuclAT_28 - -
- 4252661..4252722 + 62 NuclAT_30 - -
- 4252661..4252722 + 62 NuclAT_30 - -
- 4252661..4252722 + 62 NuclAT_30 - -
- 4252661..4252722 + 62 NuclAT_30 - -
- 4252661..4252722 + 62 NuclAT_32 - -
- 4252661..4252722 + 62 NuclAT_32 - -
- 4252661..4252722 + 62 NuclAT_32 - -
- 4252661..4252722 + 62 NuclAT_32 - -
- 4252661..4252723 + 63 NuclAT_17 - -
- 4252661..4252723 + 63 NuclAT_17 - -
- 4252661..4252723 + 63 NuclAT_17 - -
- 4252661..4252723 + 63 NuclAT_17 - -
- 4252661..4252723 + 63 NuclAT_18 - -
- 4252661..4252723 + 63 NuclAT_18 - -
- 4252661..4252723 + 63 NuclAT_18 - -
- 4252661..4252723 + 63 NuclAT_18 - -
- 4252661..4252723 + 63 NuclAT_19 - -
- 4252661..4252723 + 63 NuclAT_19 - -
- 4252661..4252723 + 63 NuclAT_19 - -
- 4252661..4252723 + 63 NuclAT_19 - -
- 4252661..4252723 + 63 NuclAT_20 - -
- 4252661..4252723 + 63 NuclAT_20 - -
- 4252661..4252723 + 63 NuclAT_20 - -
- 4252661..4252723 + 63 NuclAT_20 - -
- 4252661..4252723 + 63 NuclAT_22 - -
- 4252661..4252723 + 63 NuclAT_22 - -
- 4252661..4252723 + 63 NuclAT_22 - -
- 4252661..4252723 + 63 NuclAT_22 - -
- 4252661..4252723 + 63 NuclAT_23 - -
- 4252661..4252723 + 63 NuclAT_23 - -
- 4252661..4252723 + 63 NuclAT_23 - -
- 4252661..4252723 + 63 NuclAT_23 - -
GN312_RS21175 4253037..4253144 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 4253192..4253251 + 60 NuclAT_25 - Antitoxin
- 4253192..4253251 + 60 NuclAT_25 - Antitoxin
- 4253192..4253251 + 60 NuclAT_25 - Antitoxin
- 4253192..4253251 + 60 NuclAT_25 - Antitoxin
- 4253192..4253251 + 60 NuclAT_27 - Antitoxin
- 4253192..4253251 + 60 NuclAT_27 - Antitoxin
- 4253192..4253251 + 60 NuclAT_27 - Antitoxin
- 4253192..4253251 + 60 NuclAT_27 - Antitoxin
- 4253192..4253251 + 60 NuclAT_29 - Antitoxin
- 4253192..4253251 + 60 NuclAT_29 - Antitoxin
- 4253192..4253251 + 60 NuclAT_29 - Antitoxin
- 4253192..4253251 + 60 NuclAT_29 - Antitoxin
- 4253192..4253251 + 60 NuclAT_31 - Antitoxin
- 4253192..4253251 + 60 NuclAT_31 - Antitoxin
- 4253192..4253251 + 60 NuclAT_31 - Antitoxin
- 4253192..4253251 + 60 NuclAT_31 - Antitoxin
- 4253192..4253251 + 60 NuclAT_33 - Antitoxin
- 4253192..4253251 + 60 NuclAT_33 - Antitoxin
- 4253192..4253251 + 60 NuclAT_33 - Antitoxin
- 4253192..4253251 + 60 NuclAT_33 - Antitoxin
GN312_RS21180 4253543..4254643 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
GN312_RS21185 4254913..4255143 + 231 WP_001146444.1 putative cation transport regulator ChaB -
GN312_RS21190 4255304..4255999 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
GN312_RS21195 4256043..4256396 - 354 WP_001169661.1 DsrE/F sulfur relay family protein YchN -
GN312_RS21200 4256582..4257976 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T144387 WP_000170963.1 NZ_CP046527:c4253144-4253037 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T144387 NZ_CP061943:c1748077-1747895 [Pseudomonas chlororaphis]
GTGAACAGTCGGTATTTGATCGGCCAAATCGTCGCAGACGGTTGGTATCTGGTCAGGGTCAAAGGCAGTCACCACCATTT
CAGGCACCCCAGTAAACCGGGGCTGGTGACAGTTCCACAGCCCAAAAAAGACCTGCTGAGAAAAACCGCCATCAGCATTC
TGAAACAGGCGCTGCTCATGTGA

Antitoxin


Download         Length: 60 bp

>AT144387 NZ_CP046527:4253192-4253251 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References