Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 24864..25133 | Replicon | plasmid p2947-NDM5 |
| Accession | NZ_CP046261 | ||
| Organism | Escherichia coli strain ECO2947 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | GK046_RS24440 | Protein ID | WP_001312861.1 |
| Coordinates | 24975..25133 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 24864..24929 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GK046_RS24410 | 20574..21101 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| GK046_RS24415 | 21159..21392 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| GK046_RS24420 | 21453..23476 | + | 2024 | Protein_31 | ParB/RepB/Spo0J family partition protein | - |
| GK046_RS24425 | 23545..23979 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| GK046_RS24430 | 23976..24695 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 24707..24931 | + | 225 | NuclAT_0 | - | - |
| - | 24707..24931 | + | 225 | NuclAT_0 | - | - |
| - | 24707..24931 | + | 225 | NuclAT_0 | - | - |
| - | 24707..24931 | + | 225 | NuclAT_0 | - | - |
| GK046_RS24435 | 24716..24895 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 24864..24929 | + | 66 | - | - | Antitoxin |
| GK046_RS24440 | 24975..25133 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| GK046_RS24845 | 25371..25748 | - | 378 | Protein_36 | hypothetical protein | - |
| GK046_RS24450 | 26048..26344 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| GK046_RS24455 | 26455..27276 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| GK046_RS24460 | 27573..28175 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| GK046_RS24465 | 28498..28881 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
| GK046_RS24470 | 29075..29746 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| GK046_RS24475 | 29883..30110 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaNDM-5 | - | 1..66053 | 66053 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T143784 WP_001312861.1 NZ_CP046261:24975-25133 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T143784 NZ_CP061367:c2828672-2828565 [Shigella sonnei]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT143784 NZ_CP046261:24864-24929 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|