Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 59416..59685 | Replicon | plasmid p2974-D |
Accession | NZ_CP046260 | ||
Organism | Escherichia coli strain ECO2947 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | GK046_RS23995 | Protein ID | WP_001312861.1 |
Coordinates | 59527..59685 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 59416..59481 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GK046_RS23965 | 55272..55724 | + | 453 | WP_000290842.1 | single-stranded DNA-binding protein | - |
GK046_RS23970 | 55786..56019 | + | 234 | WP_000006030.1 | DUF905 family protein | - |
GK046_RS23975 | 56084..58042 | + | 1959 | WP_063072993.1 | ParB/RepB/Spo0J family partition protein | - |
GK046_RS23980 | 58097..58531 | + | 435 | WP_000845907.1 | conjugation system SOS inhibitor PsiB | - |
GK046_RS23985 | 58528..59247 | + | 720 | WP_001276240.1 | plasmid SOS inhibition protein A | - |
GK046_RS23990 | 59259..59447 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 59259..59483 | + | 225 | NuclAT_0 | - | - |
- | 59259..59483 | + | 225 | NuclAT_0 | - | - |
- | 59259..59483 | + | 225 | NuclAT_0 | - | - |
- | 59259..59483 | + | 225 | NuclAT_0 | - | - |
- | 59416..59481 | + | 66 | - | - | Antitoxin |
GK046_RS23995 | 59527..59685 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
GK046_RS24820 | 60376..60582 | + | 207 | WP_033804333.1 | hypothetical protein | - |
GK046_RS24010 | 60607..60894 | + | 288 | WP_000107535.1 | hypothetical protein | - |
GK046_RS24015 | 61014..61835 | + | 822 | WP_001241365.1 | DUF945 domain-containing protein | - |
GK046_RS24020 | 62132..62734 | - | 603 | WP_000243705.1 | transglycosylase SLT domain-containing protein | - |
GK046_RS24025 | 63055..63438 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
GK046_RS24030 | 63625..64314 | + | 690 | WP_000283379.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / qnrS1 / aph(6)-Id / aph(3'')-Ib / sul2 | stcE / exeE / exeG | 1..108424 | 108424 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T143780 WP_001312861.1 NZ_CP046260:59527-59685 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T143780 NZ_CP046260:59527-59685 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT143780 NZ_CP046260:59416-59481 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|