Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 8165363..8165963 | Replicon | chromosome |
| Accession | NZ_CP046173 | ||
| Organism | Nocardia terpenica strain AUSMDU00012715 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | F6W96_RS36745 | Protein ID | WP_167490420.1 |
| Coordinates | 8165685..8165963 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | F6W96_RS36740 | Protein ID | WP_167490419.1 |
| Coordinates | 8165363..8165671 (-) | Length | 103 a.a. |
Genomic Context
Location: 8160813..8161718 (906 bp)
Type: Others
Protein ID: WP_167490415.1
Type: Others
Protein ID: WP_167490415.1
Location: 8161861..8162421 (561 bp)
Type: Others
Protein ID: WP_167490416.1
Type: Others
Protein ID: WP_167490416.1
Location: 8164729..8164893 (165 bp)
Type: Others
Protein ID: WP_167490418.1
Type: Others
Protein ID: WP_167490418.1
Location: 8162488..8163270 (783 bp)
Type: Others
Protein ID: WP_167490417.1
Type: Others
Protein ID: WP_167490417.1
Location: 8163382..8163855 (474 bp)
Type: Others
Protein ID: WP_175041437.1
Type: Others
Protein ID: WP_175041437.1
Location: 8163839..8164522 (684 bp)
Type: Others
Protein ID: WP_203217845.1
Type: Others
Protein ID: WP_203217845.1
Location: 8165363..8165671 (309 bp)
Type: Antitoxin
Protein ID: WP_167490419.1
Type: Antitoxin
Protein ID: WP_167490419.1
Location: 8165685..8165963 (279 bp)
Type: Toxin
Protein ID: WP_167490420.1
Type: Toxin
Protein ID: WP_167490420.1
Location: 8166120..8167103 (984 bp)
Type: Others
Protein ID: WP_167492049.1
Type: Others
Protein ID: WP_167492049.1
Location: 8167106..8168749 (1644 bp)
Type: Others
Protein ID: WP_167490421.1
Type: Others
Protein ID: WP_167490421.1
Location: 8168749..8169582 (834 bp)
Type: Others
Protein ID: WP_167490422.1
Type: Others
Protein ID: WP_167490422.1
Location: 8169579..8170175 (597 bp)
Type: Others
Protein ID: WP_167490423.1
Type: Others
Protein ID: WP_167490423.1
Location: 8170172..8170777 (606 bp)
Type: Others
Protein ID: WP_167492050.1
Type: Others
Protein ID: WP_167492050.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F6W96_RS36710 | 8160813..8161718 | + | 906 | WP_167490415.1 | LysR family transcriptional regulator | - |
| F6W96_RS36715 | 8161861..8162421 | + | 561 | WP_167490416.1 | hypothetical protein | - |
| F6W96_RS36720 | 8162488..8163270 | - | 783 | WP_167490417.1 | hypothetical protein | - |
| F6W96_RS36725 | 8163382..8163855 | - | 474 | WP_175041437.1 | NUDIX domain-containing protein | - |
| F6W96_RS36730 | 8163839..8164522 | - | 684 | WP_203217845.1 | hypothetical protein | - |
| F6W96_RS36735 | 8164729..8164893 | + | 165 | WP_167490418.1 | hypothetical protein | - |
| F6W96_RS36740 | 8165363..8165671 | - | 309 | WP_167490419.1 | HigA family addiction module antidote protein | Antitoxin |
| F6W96_RS36745 | 8165685..8165963 | - | 279 | WP_167490420.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| F6W96_RS36750 | 8166120..8167103 | - | 984 | WP_167492049.1 | c-type cytochrome biogenesis protein CcsB | - |
| F6W96_RS36755 | 8167106..8168749 | - | 1644 | WP_167490421.1 | cytochrome c biogenesis protein ResB | - |
| F6W96_RS36760 | 8168749..8169582 | - | 834 | WP_167490422.1 | cytochrome c biogenesis CcdA family protein | - |
| F6W96_RS36765 | 8169579..8170175 | - | 597 | WP_167490423.1 | TlpA family protein disulfide reductase | - |
| F6W96_RS36770 | 8170172..8170777 | - | 606 | WP_167492050.1 | histidine phosphatase family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10665.24 Da Isoelectric Point: 9.7892
>T143714 WP_167490420.1 NZ_CP046173:c8165963-8165685 [Nocardia terpenica]
VIQSFKDKEAQKLWTERSAPKLGNVQKVALRKLTMLDAAAQLDDLRVPPANRLEKLKGDREGQHSIRINDQWRICFVWET
AGPRDVEIINYH
VIQSFKDKEAQKLWTERSAPKLGNVQKVALRKLTMLDAAAQLDDLRVPPANRLEKLKGDREGQHSIRINDQWRICFVWET
AGPRDVEIINYH
Download Length: 279 bp
>T143714 NZ_CP061337:c1957163-1957056 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 103 a.a. Molecular weight: 11519.36 Da Isoelectric Point: 9.9105
>AT143714 WP_167490419.1 NZ_CP046173:c8165671-8165363 [Nocardia terpenica]
MANATPLPPTSPGEILAEEFMEPLRISQNALARALGVPARRINQIVHGKRAITTRTALLLARYFGTTPEFWINLQTHYDL
VREREELSDKLGRIVPRQPLTC
MANATPLPPTSPGEILAEEFMEPLRISQNALARALGVPARRINQIVHGKRAITTRTALLLARYFGTTPEFWINLQTHYDL
VREREELSDKLGRIVPRQPLTC
Download Length: 309 bp
>AT143714 NZ_CP061337:1957211-1957277 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC