Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 72367..72608 | Replicon | plasmid pAD1 |
Accession | NZ_CP046109 | ||
Organism | Enterococcus faecalis strain 133170041-3 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | GKQ57_RS14330 | Protein ID | WP_002360667.1 |
Coordinates | 72367..72477 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 72517..72608 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GKQ57_RS14290 | 67646..67948 | + | 303 | WP_002367825.1 | hypothetical protein | - |
GKQ57_RS14295 | 68288..68908 | + | 621 | WP_021732893.1 | recombinase family protein | - |
GKQ57_RS14300 | 68925..69212 | + | 288 | WP_010708491.1 | hypothetical protein | - |
GKQ57_RS14305 | 69206..69430 | + | 225 | WP_010708492.1 | hypothetical protein | - |
GKQ57_RS14310 | 69491..69700 | + | 210 | WP_002387638.1 | hypothetical protein | - |
GKQ57_RS14315 | 69712..70014 | + | 303 | WP_002365939.1 | hypothetical protein | - |
GKQ57_RS14320 | 70441..71769 | + | 1329 | WP_021732894.1 | Y-family DNA polymerase | - |
GKQ57_RS14325 | 71766..72116 | + | 351 | WP_002399364.1 | hypothetical protein | - |
GKQ57_RS14330 | 72367..72477 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 72517..72608 | - | 92 | NuclAT_0 | - | Antitoxin |
- | 72517..72608 | - | 92 | NuclAT_0 | - | Antitoxin |
- | 72517..72608 | - | 92 | NuclAT_0 | - | Antitoxin |
- | 72517..72608 | - | 92 | NuclAT_0 | - | Antitoxin |
GKQ57_RS14335 | 72717..73013 | + | 297 | WP_002360665.1 | replication control protein PrgN | - |
GKQ57_RS14340 | 73267..74049 | + | 783 | WP_002360664.1 | ParA family protein | - |
GKQ57_RS14345 | 74042..74398 | + | 357 | WP_002360663.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | prgB/asc10 | 1..74657 | 74657 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T143539 WP_002360667.1 NZ_CP046109:72367-72477 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
>T143539 NZ_CP061185:c4626610-4626503 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 92 bp
>AT143539 NZ_CP046109:c72608-72517 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|