Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symER/SymE(toxin) |
| Location | 3553916..3554316 | Replicon | chromosome |
| Accession | NZ_CP045720 | ||
| Organism | Pantoea eucalypti strain LMG 24197 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | - |
| Locus tag | EE896_RS16625 | Protein ID | WP_078804792.1 |
| Coordinates | 3553916..3554245 (-) | Length | 110 a.a. |
Antitoxin (RNA)
| Gene name | symR | ||
| Locus tag | - | ||
| Coordinates | 3554263..3554316 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EE896_RS16595 | 3549634..3550218 | - | 585 | WP_140916162.1 | DJ-1/PfpI family protein | - |
| EE896_RS16600 | 3550509..3551318 | - | 810 | WP_140916193.1 | CDP-diacylglycerol diphosphatase | - |
| EE896_RS16605 | 3551388..3551696 | - | 309 | WP_003850923.1 | hypothetical protein | - |
| EE896_RS16610 | 3551715..3552140 | - | 426 | WP_039658869.1 | hypothetical protein | - |
| EE896_RS16615 | 3552137..3552838 | - | 702 | WP_039658871.1 | hypothetical protein | - |
| EE896_RS16620 | 3552993..3553349 | - | 357 | WP_110411681.1 | hypothetical protein | - |
| EE896_RS16625 | 3553916..3554245 | - | 330 | WP_078804792.1 | endoribonuclease SymE | Toxin |
| - | 3554263..3554316 | + | 54 | NuclAT_0 | - | Antitoxin |
| - | 3554263..3554316 | + | 54 | NuclAT_0 | - | Antitoxin |
| - | 3554263..3554316 | + | 54 | NuclAT_0 | - | Antitoxin |
| - | 3554263..3554316 | + | 54 | NuclAT_0 | - | Antitoxin |
| - | 3554263..3554316 | + | 54 | NuclAT_1 | - | Antitoxin |
| - | 3554263..3554316 | + | 54 | NuclAT_1 | - | Antitoxin |
| - | 3554263..3554316 | + | 54 | NuclAT_1 | - | Antitoxin |
| - | 3554263..3554316 | + | 54 | NuclAT_1 | - | Antitoxin |
| EE896_RS16630 | 3554505..3554635 | - | 131 | Protein_3244 | restriction endonuclease subunit S | - |
| EE896_RS16635 | 3555025..3555798 | + | 774 | WP_110411682.1 | type IV toxin-antitoxin system AbiEi family antitoxin | - |
| EE896_RS16640 | 3555791..3555979 | + | 189 | Protein_3246 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| EE896_RS16645 | 3556345..3557358 | - | 1014 | WP_140916161.1 | restriction endonuclease | - |
| EE896_RS16650 | 3557473..3558069 | - | 597 | WP_140916160.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3551715..3566774 | 15059 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12067.89 Da Isoelectric Point: 9.1097
>T142387 WP_078804792.1 NZ_CP045720:c3554245-3553916 [Pantoea eucalypti]
MTDAHSIAQLSEPEVSPSNNRQLTVGYASRYPDYSRIPAITMKGQWLEAAGFVTGTAVEVKVMEGCIVLTARQESELVQS
LRQVCKLSARKQKQVQEFIQVISGKQKVV
MTDAHSIAQLSEPEVSPSNNRQLTVGYASRYPDYSRIPAITMKGQWLEAAGFVTGTAVEVKVMEGCIVLTARQESELVQS
LRQVCKLSARKQKQVQEFIQVISGKQKVV
Download Length: 330 bp
>T142387 NZ_CP060674:1817475-1817630 [Salmonella enterica]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 54 bp
>AT142387 NZ_CP045720:3554263-3554316 [Pantoea eucalypti]
AATAGTGATTGTGATTAGCGGCGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AATAGTGATTGTGATTAGCGGCGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|