Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2249995..2250220 | Replicon | chromosome |
Accession | NZ_CP045522 | ||
Organism | Shigella flexneri strain 5908.2 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | GE167_RS11335 | Protein ID | WP_000813254.1 |
Coordinates | 2250065..2250220 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2249995..2250053 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GE167_RS24270 | 2245993..2246162 | + | 170 | Protein_2228 | hypothetical protein | - |
GE167_RS11300 | 2246308..2247054 | + | 747 | WP_000788996.1 | ATP-binding protein | - |
GE167_RS11305 | 2247069..2247491 | + | 423 | WP_001118171.1 | DUF977 family protein | - |
GE167_RS11310 | 2247549..2247905 | + | 357 | WP_000403784.1 | hypothetical protein | - |
GE167_RS11315 | 2247998..2248216 | + | 219 | WP_000256997.1 | DUF4014 family protein | - |
GE167_RS11320 | 2248218..2248580 | + | 363 | Protein_2233 | HNH endonuclease | - |
GE167_RS24275 | 2248580..2249245 | + | 666 | WP_005115317.1 | hypothetical protein | - |
GE167_RS11330 | 2249245..2249610 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
- | 2249995..2250053 | - | 59 | - | - | Antitoxin |
GE167_RS11335 | 2250065..2250220 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
GE167_RS11350 | 2251557..2252156 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
GE167_RS11355 | 2252156..2252446 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
GE167_RS11360 | 2252443..2252997 | + | 555 | WP_000640143.1 | DUF1133 family protein | - |
GE167_RS11365 | 2253409..2254596 | - | 1188 | Protein_2241 | IS91 family transposase | - |
GE167_RS11370 | 2254596..2254961 | - | 366 | WP_000124119.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2230689..2258300 | 27611 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T142034 WP_000813254.1 NZ_CP045522:2250065-2250220 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T142034 NZ_CP060289:c4132748-4132566 [Pseudomonas protegens]
ATGCGCAGTCGGGAGATGATCGGCAAGATCGAGGCGGATGGTTGGTACCTGATCGCCGTGAAGGGCAGTCACCATCAGTA
CAAGCATCCCTGGAAGCCAGGGCGCGTCACCATCAGGCACCCGGATGCGGATCTGCCCCGGGGCACGATCAACAGCATCT
TGAAACAGGCGGGCCTGAAATGA
ATGCGCAGTCGGGAGATGATCGGCAAGATCGAGGCGGATGGTTGGTACCTGATCGCCGTGAAGGGCAGTCACCATCAGTA
CAAGCATCCCTGGAAGCCAGGGCGCGTCACCATCAGGCACCCGGATGCGGATCTGCCCCGGGGCACGATCAACAGCATCT
TGAAACAGGCGGGCCTGAAATGA
Antitoxin
Download Length: 59 bp
>AT142034 NZ_CP045522:c2250053-2249995 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|