Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 1988452..1988664 | Replicon | chromosome |
| Accession | NZ_CP045522 | ||
| Organism | Shigella flexneri strain 5908.2 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | E0IV43 |
| Locus tag | GE167_RS09950 | Protein ID | WP_000170926.1 |
| Coordinates | 1988452..1988559 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 1988612..1988664 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GE167_RS09920 (1983760) | 1983760..1984842 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| GE167_RS09925 (1984842) | 1984842..1985675 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| GE167_RS09930 (1985672) | 1985672..1986064 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| GE167_RS09935 (1986068) | 1986068..1986877 | + | 810 | WP_119175925.1 | invasion regulator SirB1 | - |
| GE167_RS09940 (1986913) | 1986913..1987767 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| GE167_RS09945 (1987916) | 1987916..1988023 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_22 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_22 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_22 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_22 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_25 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_25 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_25 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_25 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_28 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_28 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_28 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_28 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_31 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_31 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_31 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_31 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_34 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_34 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_34 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_34 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_37 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_37 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_37 | - | - |
| - (1988073) | 1988073..1988136 | + | 64 | NuclAT_37 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_39 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_39 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_39 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_39 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_41 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_41 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_41 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_41 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_43 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_43 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_43 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_43 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_45 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_45 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_45 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_45 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_47 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_47 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_47 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_47 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_49 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_49 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_49 | - | - |
| - (1988071) | 1988071..1988137 | + | 67 | NuclAT_49 | - | - |
| GE167_RS09950 (1988452) | 1988452..1988559 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_10 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_10 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_10 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_10 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_12 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_12 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_12 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_12 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_14 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_14 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_14 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_14 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_16 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_16 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_16 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_16 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_18 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_18 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_18 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_18 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_20 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_20 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_20 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_20 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_23 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_23 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_23 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_23 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_26 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_26 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_26 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_26 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_29 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_29 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_29 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_29 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_32 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_32 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_32 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_32 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_35 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_35 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_35 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_35 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_38 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_38 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_38 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_38 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_40 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_40 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_40 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_40 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_42 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_42 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_42 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_42 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_44 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_44 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_44 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_44 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_46 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_46 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_46 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_46 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_48 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_48 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_48 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_48 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_50 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_50 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_50 | - | Antitoxin |
| - (1988612) | 1988612..1988664 | + | 53 | NuclAT_50 | - | Antitoxin |
| GE167_RS09955 (1988678) | 1988678..1990022 | - | 1345 | Protein_1964 | IS4 family transposase | - |
| GE167_RS09960 (1990424) | 1990424..1990531 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_21 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_21 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_21 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_21 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_24 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_24 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_24 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_24 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_27 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_27 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_27 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_27 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_30 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_30 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_30 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_30 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_33 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_33 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_33 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_33 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_36 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_36 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_36 | - | - |
| - (1990579) | 1990579..1990644 | + | 66 | NuclAT_36 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_11 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_11 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_11 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_11 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_13 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_13 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_13 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_13 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_15 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_15 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_15 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_15 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_17 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_17 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_17 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_17 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_19 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_19 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_19 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_19 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_9 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_9 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_9 | - | - |
| - (1990579) | 1990579..1990646 | + | 68 | NuclAT_9 | - | - |
| GE167_RS09965 (1990936) | 1990936..1992036 | - | 1101 | WP_005067943.1 | sodium-potassium/proton antiporter ChaA | - |
| GE167_RS09970 (1992306) | 1992306..1992536 | + | 231 | WP_161550586.1 | putative cation transport regulator ChaB | - |
| GE167_RS09975 (1992694) | 1992694..1993389 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.84 Da Isoelectric Point: 11.6501
>T142029 WP_000170926.1 NZ_CP045522:c1988559-1988452 [Shigella flexneri]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T142029 NZ_CP060289:c28091-27741 [Pseudomonas protegens]
ATGAATGCTCTGTTTATTGAACTGCCGGCATTTGCACGATACCGAAGGGACTTCCTTGACGACGAGTTGTTCTGCGAACT
GCAGATCGAGTTGCTGCGCCACCCGCACGCGGGTGTTCTGATCCAGGGCACTGGCGGCTTGCGCAAGATGCGTTTCGTCG
ATGAGCGACGCAACAAGGGCAAGCGTGGCGGGTTGAGGGTGATTTATTACTGGTGGTCCGGAGGGGCGCAGTTCTGGCTC
TTCACCCTGTTCGACAAGGAGCAGATGGACGACCTGCTACCGCAGCAGCGACAACAACTCAAACAACTGCTGGAACGTGA
AATCGAGGCCAGAAGACATGACCAAACGTGA
ATGAATGCTCTGTTTATTGAACTGCCGGCATTTGCACGATACCGAAGGGACTTCCTTGACGACGAGTTGTTCTGCGAACT
GCAGATCGAGTTGCTGCGCCACCCGCACGCGGGTGTTCTGATCCAGGGCACTGGCGGCTTGCGCAAGATGCGTTTCGTCG
ATGAGCGACGCAACAAGGGCAAGCGTGGCGGGTTGAGGGTGATTTATTACTGGTGGTCCGGAGGGGCGCAGTTCTGGCTC
TTCACCCTGTTCGACAAGGAGCAGATGGACGACCTGCTACCGCAGCAGCGACAACAACTCAAACAACTGCTGGAACGTGA
AATCGAGGCCAGAAGACATGACCAAACGTGA
Antitoxin
Download Length: 53 bp
>AT142029 NZ_CP045522:1988612-1988664 [Shigella flexneri]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGG
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|