Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 2789698..2789893 | Replicon | chromosome |
Accession | NZ_CP045045 | ||
Organism | Enterococcus faecalis strain JY32 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | F9293_RS13295 | Protein ID | WP_015543884.1 |
Coordinates | 2789698..2789793 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2789828..2789893 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F9293_RS13275 | 2784875..2785990 | + | 1116 | WP_002377910.1 | FAD-binding oxidoreductase | - |
F9293_RS13280 | 2786059..2787213 | - | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
F9293_RS13285 | 2787228..2787665 | - | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
F9293_RS13290 | 2787680..2789452 | - | 1773 | WP_002391520.1 | PTS mannitol transporter subunit IICBA | - |
F9293_RS13295 | 2789698..2789793 | + | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2789828..2789893 | - | 66 | - | - | Antitoxin |
F9293_RS13300 | 2790051..2790485 | - | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
F9293_RS13305 | 2790496..2792529 | - | 2034 | WP_002355275.1 | transcription antiterminator | - |
F9293_RS13310 | 2792520..2794262 | - | 1743 | WP_002401739.1 | PTS transporter subunit EIIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T141139 WP_015543884.1 NZ_CP045045:2789698-2789793 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T141139 NZ_CP059835:c5012973-5012866 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT141139 NZ_CP045045:c2789893-2789828 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|