Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 22891..23161 | Replicon | plasmid pBK13048-6 |
Accession | NZ_CP045020 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain BK13048 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | F9865_RS27455 | Protein ID | WP_001312861.1 |
Coordinates | 23003..23161 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 22891..22954 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F9865_RS27430 | 18602..19129 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
F9865_RS27435 | 19187..19420 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
F9865_RS27440 | 19481..21504 | + | 2024 | Protein_25 | ParB/RepB/Spo0J family partition protein | - |
F9865_RS27445 | 21573..22007 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
F9865_RS27450 | 22004..22723 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 22735..22959 | + | 225 | NuclAT_0 | - | - |
- | 22735..22959 | + | 225 | NuclAT_0 | - | - |
- | 22735..22959 | + | 225 | NuclAT_0 | - | - |
- | 22735..22959 | + | 225 | NuclAT_0 | - | - |
- | 22891..22954 | - | 64 | - | - | Antitoxin |
F9865_RS27455 | 23003..23161 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
F9865_RS27460 | 23519..23944 | + | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
F9865_RS27465 | 23941..24291 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
F9865_RS27470 | 24322..25935 | + | 1614 | WP_000080200.1 | IS66-like element ISEc23 family transposase | - |
F9865_RS28400 | 26020..26224 | - | 205 | Protein_32 | pilus protein | - |
F9865_RS27490 | 26671..27368 | + | 698 | Protein_33 | IS1 family transposase | - |
F9865_RS27495 | 27365..27931 | + | 567 | WP_151887008.1 | DUF2726 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..28729 | 28729 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T141120 WP_001312861.1 NZ_CP045020:23003-23161 [Klebsiella pneumoniae subsp. pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T141120 NZ_CP059825:32896-33153 [Enterococcus faecium]
ATGATTAAGGCTTGGTCTGATGATGCTTGGGATGATTATCTTTATTGGCATGAGCAAGGAAACAAAAGCAATATAAAAAA
GATTAACAAGTTAATAAAAGATATCGATCGTTCCCCCTTTGCTGGATTAGGAAAACCTGAGCCATTAAAGCATGATTTAT
CTGGAAAATGGTCCAGAAGAATTACAGATGAACATAGACTGATATATAGAGTTGAAAATGAAACGATATTTATTTATTCT
GCAAAAGATCACTATTAA
ATGATTAAGGCTTGGTCTGATGATGCTTGGGATGATTATCTTTATTGGCATGAGCAAGGAAACAAAAGCAATATAAAAAA
GATTAACAAGTTAATAAAAGATATCGATCGTTCCCCCTTTGCTGGATTAGGAAAACCTGAGCCATTAAAGCATGATTTAT
CTGGAAAATGGTCCAGAAGAATTACAGATGAACATAGACTGATATATAGAGTTGAAAATGAAACGATATTTATTTATTCT
GCAAAAGATCACTATTAA
Antitoxin
Download Length: 64 bp
>AT141120 NZ_CP045020:c22954-22891 [Klebsiella pneumoniae subsp. pneumoniae]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|