Detailed information of TA system TA140971

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2612205..2612425
• Replicon: chromosome
• Accession: NZ_CP044443
• Organism: Escherichia coli strain HeN100

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: HeN100_RS14455
• Protein ID: WP_000170963.1
• Coordinates: 2612318..2612425 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2612205..2612271 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HeN100_RS14430	2607483..2608877	-	1395	WP_001400233.1	inverse autotransporter invasin YchO	-
HeN100_RS14435	2609063..2609416	+	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
HeN100_RS14440	2609460..2610155	-	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
HeN100_RS14445	2610313..2610543	-	231	WP_001146444.1	putative cation transport regulator ChaB	-
HeN100_RS14450	2610813..2611913	+	1101	WP_000063607.1	sodium-potassium/proton antiporter ChaA	-
-	2612205..2612271	-	67	-	-	Antitoxin
HeN100_RS14455	2612318..2612425	+	108	WP_000170963.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2612739..2612805	-	67	NuclAT_34	-	-
-	2612739..2612805	-	67	NuclAT_34	-	-
-	2612739..2612805	-	67	NuclAT_34	-	-
-	2612739..2612805	-	67	NuclAT_34	-	-
-	2612740..2612803	-	64	NuclAT_16	-	-
-	2612740..2612803	-	64	NuclAT_16	-	-
-	2612740..2612803	-	64	NuclAT_16	-	-
-	2612740..2612803	-	64	NuclAT_16	-	-
-	2612740..2612803	-	64	NuclAT_18	-	-
-	2612740..2612803	-	64	NuclAT_18	-	-
-	2612740..2612803	-	64	NuclAT_18	-	-
-	2612740..2612803	-	64	NuclAT_18	-	-
-	2612740..2612803	-	64	NuclAT_20	-	-
-	2612740..2612803	-	64	NuclAT_20	-	-
-	2612740..2612803	-	64	NuclAT_20	-	-
-	2612740..2612803	-	64	NuclAT_20	-	-
-	2612740..2612803	-	64	NuclAT_22	-	-
-	2612740..2612803	-	64	NuclAT_22	-	-
-	2612740..2612803	-	64	NuclAT_22	-	-
-	2612740..2612803	-	64	NuclAT_22	-	-
-	2612740..2612803	-	64	NuclAT_25	-	-
-	2612740..2612803	-	64	NuclAT_25	-	-
-	2612740..2612803	-	64	NuclAT_25	-	-
-	2612740..2612803	-	64	NuclAT_25	-	-
-	2612740..2612803	-	64	NuclAT_27	-	-
-	2612740..2612803	-	64	NuclAT_27	-	-
-	2612740..2612803	-	64	NuclAT_27	-	-
-	2612740..2612803	-	64	NuclAT_27	-	-
HeN100_RS14460	2612853..2612960	+	108	WP_000170955.1	type I toxin-antitoxin system toxin Ldr family protein	-
HeN100_RS14465	2613109..2613963	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
HeN100_RS14470	2613999..2614808	-	810	WP_001257044.1	invasion regulator SirB1	-
HeN100_RS14475	2614812..2615204	-	393	WP_000200373.1	invasion regulator SirB2	-
HeN100_RS14480	2615201..2616034	-	834	WP_000456454.1	peptide chain release factor N(5)-glutamine methyltransferase	-
HeN100_RS14485	2616034..2617116	-	1083	WP_000804726.1	peptide chain release factor 1	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T140971 WP_000170963.1 NZ_CP044443:2612318-2612425 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T140971 NZ_CP059586:427390-427542 [Xanthomonas oryzae pv. oryzae]
ATGAAGCGACTGCTGACACTGATGGTGCTGGGCCTGTTTTCGGCCGGCGTGATGACGGGCTGCAACACCGTGGCTGGCGC
TGGCAAGGACTTGCAGGGCGCGGGTGGGAAGGTCGAGAAAACGGCCGAAAAATGCAGCGATGGTAAGTGCTGA

Antitoxin

Nucleotide

• Length: 67 bp

>AT140971 NZ_CP044443:c2612271-2612205 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin