Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 82862..83115 | Replicon | plasmid pHeN100_03 |
Accession | NZ_CP044440 | ||
Organism | Escherichia coli strain HeN100 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | HeN100_RS01685 | Protein ID | WP_001312851.1 |
Coordinates | 82966..83115 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 82862..82921 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HeN100_RS01660 (79589) | 79589..80335 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
HeN100_RS01665 (80390) | 80390..80950 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
HeN100_RS01670 (81082) | 81082..81282 | + | 201 | WP_015059022.1 | hypothetical protein | - |
HeN100_RS01675 (81668) | 81668..82267 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
HeN100_RS01680 (82329) | 82329..82661 | + | 333 | WP_152916585.1 | hypothetical protein | - |
- (82862) | 82862..82921 | - | 60 | NuclAT_1 | - | Antitoxin |
- (82862) | 82862..82921 | - | 60 | NuclAT_1 | - | Antitoxin |
- (82862) | 82862..82921 | - | 60 | NuclAT_1 | - | Antitoxin |
- (82862) | 82862..82921 | - | 60 | NuclAT_1 | - | Antitoxin |
HeN100_RS01685 (82966) | 82966..83115 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
HeN100_RS01690 (83399) | 83399..83647 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aph(3')-VI / blaNDM-1 / blaTEM-1B / rmtB | htpB | 1..83958 | 83958 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T140956 WP_001312851.1 NZ_CP044440:82966-83115 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T140956 NZ_CP059583:420672-420824 [Xanthomonas oryzae pv. oryzae]
ATGAAGCGACTGCTGACACTGATGGTGCTGGGCCTGTTTTCGGCCGGCGTGATGACGGGCTGCAACACCGTGGCTGGCGC
TGGCAAGGACTTGCAGGGCGCGGGTGGGAAGGTCGAGAAAACGGCCGAAAAATGCAGCGATGGTAAGTGCTGA
ATGAAGCGACTGCTGACACTGATGGTGCTGGGCCTGTTTTCGGCCGGCGTGATGACGGGCTGCAACACCGTGGCTGGCGC
TGGCAAGGACTTGCAGGGCGCGGGTGGGAAGGTCGAGAAAACGGCCGAAAAATGCAGCGATGGTAAGTGCTGA
Antitoxin
Download Length: 60 bp
>AT140956 NZ_CP044440:c82921-82862 [Escherichia coli]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|