Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1976995..1977217 Replicon chromosome
Accession NZ_CP044410
Organism Escherichia coli strain ecMN1F

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag FNW43_RS09540 Protein ID WP_000170955.1
Coordinates 1976995..1977102 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1977150..1977217 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FNW43_RS09500 1972851..1973684 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
FNW43_RS09505 1973681..1974073 + 393 WP_000200374.1 invasion regulator SirB2 -
FNW43_RS09510 1974077..1974886 + 810 WP_001257044.1 invasion regulator SirB1 -
FNW43_RS09515 1974922..1975776 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
FNW43_RS09520 1975925..1976032 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1976080..1976146 + 67 NuclAT_34 - -
- 1976080..1976146 + 67 NuclAT_34 - -
- 1976080..1976146 + 67 NuclAT_34 - -
- 1976080..1976146 + 67 NuclAT_34 - -
- 1976080..1976146 + 67 NuclAT_36 - -
- 1976080..1976146 + 67 NuclAT_36 - -
- 1976080..1976146 + 67 NuclAT_36 - -
- 1976080..1976146 + 67 NuclAT_36 - -
- 1976080..1976146 + 67 NuclAT_38 - -
- 1976080..1976146 + 67 NuclAT_38 - -
- 1976080..1976146 + 67 NuclAT_38 - -
- 1976080..1976146 + 67 NuclAT_38 - -
- 1976080..1976146 + 67 NuclAT_40 - -
- 1976080..1976146 + 67 NuclAT_40 - -
- 1976080..1976146 + 67 NuclAT_40 - -
- 1976080..1976146 + 67 NuclAT_40 - -
- 1976080..1976146 + 67 NuclAT_42 - -
- 1976080..1976146 + 67 NuclAT_42 - -
- 1976080..1976146 + 67 NuclAT_42 - -
- 1976080..1976146 + 67 NuclAT_42 - -
- 1976080..1976146 + 67 NuclAT_44 - -
- 1976080..1976146 + 67 NuclAT_44 - -
- 1976080..1976146 + 67 NuclAT_44 - -
- 1976080..1976146 + 67 NuclAT_44 - -
- 1976082..1976147 + 66 NuclAT_18 - -
- 1976082..1976147 + 66 NuclAT_18 - -
- 1976082..1976147 + 66 NuclAT_18 - -
- 1976082..1976147 + 66 NuclAT_18 - -
- 1976082..1976147 + 66 NuclAT_21 - -
- 1976082..1976147 + 66 NuclAT_21 - -
- 1976082..1976147 + 66 NuclAT_21 - -
- 1976082..1976147 + 66 NuclAT_21 - -
- 1976082..1976147 + 66 NuclAT_24 - -
- 1976082..1976147 + 66 NuclAT_24 - -
- 1976082..1976147 + 66 NuclAT_24 - -
- 1976082..1976147 + 66 NuclAT_24 - -
- 1976082..1976147 + 66 NuclAT_27 - -
- 1976082..1976147 + 66 NuclAT_27 - -
- 1976082..1976147 + 66 NuclAT_27 - -
- 1976082..1976147 + 66 NuclAT_27 - -
- 1976082..1976147 + 66 NuclAT_30 - -
- 1976082..1976147 + 66 NuclAT_30 - -
- 1976082..1976147 + 66 NuclAT_30 - -
- 1976082..1976147 + 66 NuclAT_30 - -
- 1976082..1976147 + 66 NuclAT_33 - -
- 1976082..1976147 + 66 NuclAT_33 - -
- 1976082..1976147 + 66 NuclAT_33 - -
- 1976082..1976147 + 66 NuclAT_33 - -
FNW43_RS09530 1976460..1976567 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1976615..1976682 + 68 NuclAT_17 - -
- 1976615..1976682 + 68 NuclAT_17 - -
- 1976615..1976682 + 68 NuclAT_17 - -
- 1976615..1976682 + 68 NuclAT_17 - -
- 1976615..1976682 + 68 NuclAT_20 - -
- 1976615..1976682 + 68 NuclAT_20 - -
- 1976615..1976682 + 68 NuclAT_20 - -
- 1976615..1976682 + 68 NuclAT_20 - -
- 1976615..1976682 + 68 NuclAT_23 - -
- 1976615..1976682 + 68 NuclAT_23 - -
- 1976615..1976682 + 68 NuclAT_23 - -
- 1976615..1976682 + 68 NuclAT_23 - -
- 1976615..1976682 + 68 NuclAT_26 - -
- 1976615..1976682 + 68 NuclAT_26 - -
- 1976615..1976682 + 68 NuclAT_26 - -
- 1976615..1976682 + 68 NuclAT_26 - -
- 1976615..1976682 + 68 NuclAT_29 - -
- 1976615..1976682 + 68 NuclAT_29 - -
- 1976615..1976682 + 68 NuclAT_29 - -
- 1976615..1976682 + 68 NuclAT_29 - -
- 1976615..1976682 + 68 NuclAT_32 - -
- 1976615..1976682 + 68 NuclAT_32 - -
- 1976615..1976682 + 68 NuclAT_32 - -
- 1976615..1976682 + 68 NuclAT_32 - -
- 1976616..1976681 + 66 NuclAT_35 - -
- 1976616..1976681 + 66 NuclAT_35 - -
- 1976616..1976681 + 66 NuclAT_35 - -
- 1976616..1976681 + 66 NuclAT_35 - -
- 1976616..1976681 + 66 NuclAT_37 - -
- 1976616..1976681 + 66 NuclAT_37 - -
- 1976616..1976681 + 66 NuclAT_37 - -
- 1976616..1976681 + 66 NuclAT_37 - -
- 1976616..1976681 + 66 NuclAT_39 - -
- 1976616..1976681 + 66 NuclAT_39 - -
- 1976616..1976681 + 66 NuclAT_39 - -
- 1976616..1976681 + 66 NuclAT_39 - -
- 1976616..1976681 + 66 NuclAT_41 - -
- 1976616..1976681 + 66 NuclAT_41 - -
- 1976616..1976681 + 66 NuclAT_41 - -
- 1976616..1976681 + 66 NuclAT_41 - -
- 1976616..1976681 + 66 NuclAT_43 - -
- 1976616..1976681 + 66 NuclAT_43 - -
- 1976616..1976681 + 66 NuclAT_43 - -
- 1976616..1976681 + 66 NuclAT_43 - -
- 1976616..1976681 + 66 NuclAT_45 - -
- 1976616..1976681 + 66 NuclAT_45 - -
- 1976616..1976681 + 66 NuclAT_45 - -
- 1976616..1976681 + 66 NuclAT_45 - -
FNW43_RS09540 1976995..1977102 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC Toxin
- 1977150..1977217 + 68 NuclAT_16 - Antitoxin
- 1977150..1977217 + 68 NuclAT_16 - Antitoxin
- 1977150..1977217 + 68 NuclAT_16 - Antitoxin
- 1977150..1977217 + 68 NuclAT_16 - Antitoxin
- 1977150..1977217 + 68 NuclAT_19 - Antitoxin
- 1977150..1977217 + 68 NuclAT_19 - Antitoxin
- 1977150..1977217 + 68 NuclAT_19 - Antitoxin
- 1977150..1977217 + 68 NuclAT_19 - Antitoxin
- 1977150..1977217 + 68 NuclAT_22 - Antitoxin
- 1977150..1977217 + 68 NuclAT_22 - Antitoxin
- 1977150..1977217 + 68 NuclAT_22 - Antitoxin
- 1977150..1977217 + 68 NuclAT_22 - Antitoxin
- 1977150..1977217 + 68 NuclAT_25 - Antitoxin
- 1977150..1977217 + 68 NuclAT_25 - Antitoxin
- 1977150..1977217 + 68 NuclAT_25 - Antitoxin
- 1977150..1977217 + 68 NuclAT_25 - Antitoxin
- 1977150..1977217 + 68 NuclAT_28 - Antitoxin
- 1977150..1977217 + 68 NuclAT_28 - Antitoxin
- 1977150..1977217 + 68 NuclAT_28 - Antitoxin
- 1977150..1977217 + 68 NuclAT_28 - Antitoxin
- 1977150..1977217 + 68 NuclAT_31 - Antitoxin
- 1977150..1977217 + 68 NuclAT_31 - Antitoxin
- 1977150..1977217 + 68 NuclAT_31 - Antitoxin
- 1977150..1977217 + 68 NuclAT_31 - Antitoxin
FNW43_RS09550 1977506..1978606 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
FNW43_RS09555 1978876..1979106 + 231 WP_001146444.1 putative cation transport regulator ChaB -
FNW43_RS09560 1979264..1979959 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
FNW43_RS09565 1980003..1980356 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
FNW43_RS09570 1980541..1981935 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T140884 WP_000170955.1 NZ_CP044410:c1977102-1976995 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T140884 NZ_CP059490:336179-336484 [Ralstonia solanacearum]
ATGACGATGGCCCAACGCACCATCAAGACCCGGCCGTGGGATTCGGCCGAACACCTCCGGACCGAAGCGGACATCGCCGC
CTACCTCGACGCCTGCCTGGAAGAAGCCGGAGATGACCCCGCCTTCATCACGCATGCGCTGGGCGTGGTCGCGCGCTCGC
GCGGCATGACGCAGCTCGCCCGCGAGACCGGGATGACCCGCGAGGGGCTGTACAAGGCGCTTTCCGAGGGCGGCAATCCG
AGCTTTGCGACCGTGCTGAAGGTCATCCGGGCGCTCGGCATCCGGCTGCACGCCGTGCCGACCTGA

Antitoxin


Download         Length: 68 bp

>AT140884 NZ_CP044410:1977150-1977217 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References