Detailed information of TA system TA140836

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2206509..2206730
• Replicon: chromosome
• Accession: NZ_CP044403
• Organism: Escherichia coli strain NMBU-W10C18

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A229AEQ8
• Locus tag: F7O57_RS10860
• Protein ID: WP_000176713.1
• Coordinates: 2206509..2206616 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2206664..2206730 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
F7O57_RS10830	2201643..2202725	+	1083	WP_000804726.1	peptide chain release factor 1	-
F7O57_RS10835	2202725..2203558	+	834	WP_000456570.1	peptide chain release factor N(5)-glutamine methyltransferase	-
F7O57_RS10840	2203555..2203947	+	393	WP_000200377.1	invasion regulator SirB2	-
F7O57_RS10845	2203951..2204760	+	810	WP_001257044.1	invasion regulator SirB1	-
F7O57_RS10850	2204796..2205650	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
F7O57_RS10855	2205845..2206303	+	459	WP_000526135.1	IS200/IS605 family transposase	-
F7O57_RS10860	2206509..2206616	-	108	WP_000176713.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2206664..2206730	+	67	NuclAT_21	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_21	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_21	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_21	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_26	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_26	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_26	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_26	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_31	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_31	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_31	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_31	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_36	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_36	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_36	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_36	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_38	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_38	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_38	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_38	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_43	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_43	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_43	-	Antitoxin
-	2206664..2206730	+	67	NuclAT_43	-	Antitoxin
-	2206666..2206729	+	64	NuclAT_46	-	-
-	2206666..2206729	+	64	NuclAT_46	-	-
-	2206666..2206729	+	64	NuclAT_46	-	-
-	2206666..2206729	+	64	NuclAT_46	-	-
-	2206666..2206729	+	64	NuclAT_48	-	-
-	2206666..2206729	+	64	NuclAT_48	-	-
-	2206666..2206729	+	64	NuclAT_48	-	-
-	2206666..2206729	+	64	NuclAT_48	-	-
F7O57_RS10865	2207044..2207151	-	108	WP_000170955.1	small toxic polypeptide LdrA/LdrC	-
-	2207204..2207265	+	62	NuclAT_45	-	-
-	2207204..2207265	+	62	NuclAT_45	-	-
-	2207204..2207265	+	62	NuclAT_45	-	-
-	2207204..2207265	+	62	NuclAT_45	-	-
-	2207204..2207265	+	62	NuclAT_47	-	-
-	2207204..2207265	+	62	NuclAT_47	-	-
-	2207204..2207265	+	62	NuclAT_47	-	-
-	2207204..2207265	+	62	NuclAT_47	-	-
-	2207204..2207266	+	63	NuclAT_22	-	-
-	2207204..2207266	+	63	NuclAT_22	-	-
-	2207204..2207266	+	63	NuclAT_22	-	-
-	2207204..2207266	+	63	NuclAT_22	-	-
-	2207204..2207266	+	63	NuclAT_27	-	-
-	2207204..2207266	+	63	NuclAT_27	-	-
-	2207204..2207266	+	63	NuclAT_27	-	-
-	2207204..2207266	+	63	NuclAT_27	-	-
-	2207204..2207266	+	63	NuclAT_32	-	-
-	2207204..2207266	+	63	NuclAT_32	-	-
-	2207204..2207266	+	63	NuclAT_32	-	-
-	2207204..2207266	+	63	NuclAT_32	-	-
-	2207204..2207266	+	63	NuclAT_37	-	-
-	2207204..2207266	+	63	NuclAT_37	-	-
-	2207204..2207266	+	63	NuclAT_37	-	-
-	2207204..2207266	+	63	NuclAT_37	-	-
-	2207204..2207266	+	63	NuclAT_39	-	-
-	2207204..2207266	+	63	NuclAT_39	-	-
-	2207204..2207266	+	63	NuclAT_39	-	-
-	2207204..2207266	+	63	NuclAT_39	-	-
-	2207204..2207266	+	63	NuclAT_44	-	-
-	2207204..2207266	+	63	NuclAT_44	-	-
-	2207204..2207266	+	63	NuclAT_44	-	-
-	2207204..2207266	+	63	NuclAT_44	-	-
F7O57_RS10870	2207557..2208657	-	1101	WP_001309461.1	sodium-potassium/proton antiporter ChaA	-
F7O57_RS10875	2208927..2209157	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
F7O57_RS10880	2209315..2210010	+	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
F7O57_RS10885	2210054..2210407	-	354	WP_001169659.1	DsrE/F sulfur relay family protein YchN	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	flank	IS/Tn	-	-	2205845..2206303	458

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4031.79 Da
• Isoelectric Point: 11.4779

>T140836 WP_000176713.1 NZ_CP044403:c2206616-2206509 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T140836 NZ_CP059477:1197550-1197753 [Morganella morganii]
ATGACTAAACTGGACTATCTCATGCGCTTACGTAAGTGCACTTCTATTGAAACACTGGAACGTGTCATTGAGAAGAACAA
ATATGAACTGACTGATGATGAGCTGGAGGTTTTTTATTCAGCAGCCGATCATCGTCTGGCCGAATTAACCATGAATAAAC
TGTATGACAAAATCCCGGCATCTGTCTGGAAATTTGTCCGTTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT140836 NZ_CP044403:2206664-2206730 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A229AEQ8

Antitoxin