Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2206509..2206730 | Replicon | chromosome |
| Accession | NZ_CP044403 | ||
| Organism | Escherichia coli strain NMBU-W10C18 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A229AEQ8 |
| Locus tag | F7O57_RS10860 | Protein ID | WP_000176713.1 |
| Coordinates | 2206509..2206616 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2206664..2206730 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F7O57_RS10830 | 2201643..2202725 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| F7O57_RS10835 | 2202725..2203558 | + | 834 | WP_000456570.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| F7O57_RS10840 | 2203555..2203947 | + | 393 | WP_000200377.1 | invasion regulator SirB2 | - |
| F7O57_RS10845 | 2203951..2204760 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| F7O57_RS10850 | 2204796..2205650 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| F7O57_RS10855 | 2205845..2206303 | + | 459 | WP_000526135.1 | IS200/IS605 family transposase | - |
| F7O57_RS10860 | 2206509..2206616 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2206664..2206730 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_26 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_26 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_26 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_26 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_31 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_31 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_31 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_31 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_36 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_36 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_36 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_36 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_38 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_38 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_38 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_38 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_43 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_43 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_43 | - | Antitoxin |
| - | 2206664..2206730 | + | 67 | NuclAT_43 | - | Antitoxin |
| - | 2206666..2206729 | + | 64 | NuclAT_46 | - | - |
| - | 2206666..2206729 | + | 64 | NuclAT_46 | - | - |
| - | 2206666..2206729 | + | 64 | NuclAT_46 | - | - |
| - | 2206666..2206729 | + | 64 | NuclAT_46 | - | - |
| - | 2206666..2206729 | + | 64 | NuclAT_48 | - | - |
| - | 2206666..2206729 | + | 64 | NuclAT_48 | - | - |
| - | 2206666..2206729 | + | 64 | NuclAT_48 | - | - |
| - | 2206666..2206729 | + | 64 | NuclAT_48 | - | - |
| F7O57_RS10865 | 2207044..2207151 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| - | 2207204..2207265 | + | 62 | NuclAT_45 | - | - |
| - | 2207204..2207265 | + | 62 | NuclAT_45 | - | - |
| - | 2207204..2207265 | + | 62 | NuclAT_45 | - | - |
| - | 2207204..2207265 | + | 62 | NuclAT_45 | - | - |
| - | 2207204..2207265 | + | 62 | NuclAT_47 | - | - |
| - | 2207204..2207265 | + | 62 | NuclAT_47 | - | - |
| - | 2207204..2207265 | + | 62 | NuclAT_47 | - | - |
| - | 2207204..2207265 | + | 62 | NuclAT_47 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_22 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_22 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_22 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_22 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_27 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_27 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_27 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_27 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_32 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_32 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_32 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_32 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_37 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_37 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_37 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_37 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_39 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_39 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_39 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_39 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_44 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_44 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_44 | - | - |
| - | 2207204..2207266 | + | 63 | NuclAT_44 | - | - |
| F7O57_RS10870 | 2207557..2208657 | - | 1101 | WP_001309461.1 | sodium-potassium/proton antiporter ChaA | - |
| F7O57_RS10875 | 2208927..2209157 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| F7O57_RS10880 | 2209315..2210010 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| F7O57_RS10885 | 2210054..2210407 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2205845..2206303 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4031.79 Da Isoelectric Point: 11.4779
>T140836 WP_000176713.1 NZ_CP044403:c2206616-2206509 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T140836 NZ_CP059477:1197550-1197753 [Morganella morganii]
ATGACTAAACTGGACTATCTCATGCGCTTACGTAAGTGCACTTCTATTGAAACACTGGAACGTGTCATTGAGAAGAACAA
ATATGAACTGACTGATGATGAGCTGGAGGTTTTTTATTCAGCAGCCGATCATCGTCTGGCCGAATTAACCATGAATAAAC
TGTATGACAAAATCCCGGCATCTGTCTGGAAATTTGTCCGTTAA
ATGACTAAACTGGACTATCTCATGCGCTTACGTAAGTGCACTTCTATTGAAACACTGGAACGTGTCATTGAGAAGAACAA
ATATGAACTGACTGATGATGAGCTGGAGGTTTTTTATTCAGCAGCCGATCATCGTCTGGCCGAATTAACCATGAATAAAC
TGTATGACAAAATCCCGGCATCTGTCTGGAAATTTGTCCGTTAA
Antitoxin
Download Length: 67 bp
>AT140836 NZ_CP044403:2206664-2206730 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|