Detailed information of TA system TA140670

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2141119..2141339
• Replicon: chromosome
• Accession: NZ_CP044315
• Organism: Escherichia coli strain SJ7

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: B7LGX8
• Locus tag: F7D02_RS10770
• Protein ID: WP_000170965.1
• Coordinates: 2141232..2141339 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2141119..2141185 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
F7D02_RS10745	2136398..2137792	-	1395	WP_000086212.1	inverse autotransporter invasin YchO	-
F7D02_RS10750	2137977..2138330	+	354	WP_001169666.1	DsrE/F sulfur relay family protein YchN	-
F7D02_RS10755	2138374..2139069	-	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
F7D02_RS10760	2139227..2139457	-	231	WP_001146442.1	putative cation transport regulator ChaB	-
F7D02_RS10765	2139727..2140827	+	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
-	2141119..2141185	-	67	-	-	Antitoxin
F7D02_RS10770	2141232..2141339	+	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2141653..2141715	-	63	NuclAT_42	-	-
-	2141653..2141715	-	63	NuclAT_42	-	-
-	2141653..2141715	-	63	NuclAT_42	-	-
-	2141653..2141715	-	63	NuclAT_42	-	-
-	2141653..2141715	-	63	NuclAT_45	-	-
-	2141653..2141715	-	63	NuclAT_45	-	-
-	2141653..2141715	-	63	NuclAT_45	-	-
-	2141653..2141715	-	63	NuclAT_45	-	-
-	2141654..2141715	-	62	NuclAT_18	-	-
-	2141654..2141715	-	62	NuclAT_18	-	-
-	2141654..2141715	-	62	NuclAT_18	-	-
-	2141654..2141715	-	62	NuclAT_18	-	-
-	2141654..2141715	-	62	NuclAT_21	-	-
-	2141654..2141715	-	62	NuclAT_21	-	-
-	2141654..2141715	-	62	NuclAT_21	-	-
-	2141654..2141715	-	62	NuclAT_21	-	-
-	2141654..2141715	-	62	NuclAT_24	-	-
-	2141654..2141715	-	62	NuclAT_24	-	-
-	2141654..2141715	-	62	NuclAT_24	-	-
-	2141654..2141715	-	62	NuclAT_24	-	-
-	2141654..2141715	-	62	NuclAT_27	-	-
-	2141654..2141715	-	62	NuclAT_27	-	-
-	2141654..2141715	-	62	NuclAT_27	-	-
-	2141654..2141715	-	62	NuclAT_27	-	-
-	2141654..2141715	-	62	NuclAT_30	-	-
-	2141654..2141715	-	62	NuclAT_30	-	-
-	2141654..2141715	-	62	NuclAT_30	-	-
-	2141654..2141715	-	62	NuclAT_30	-	-
-	2141654..2141715	-	62	NuclAT_33	-	-
-	2141654..2141715	-	62	NuclAT_33	-	-
-	2141654..2141715	-	62	NuclAT_33	-	-
-	2141654..2141715	-	62	NuclAT_33	-	-
F7D02_RS10775	2141768..2141875	+	108	WP_000170926.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2142189..2142255	-	67	NuclAT_40	-	-
-	2142189..2142255	-	67	NuclAT_40	-	-
-	2142189..2142255	-	67	NuclAT_40	-	-
-	2142189..2142255	-	67	NuclAT_40	-	-
-	2142189..2142255	-	67	NuclAT_43	-	-
-	2142189..2142255	-	67	NuclAT_43	-	-
-	2142189..2142255	-	67	NuclAT_43	-	-
-	2142189..2142255	-	67	NuclAT_43	-	-
-	2142190..2142253	-	64	NuclAT_17	-	-
-	2142190..2142253	-	64	NuclAT_17	-	-
-	2142190..2142253	-	64	NuclAT_17	-	-
-	2142190..2142253	-	64	NuclAT_17	-	-
-	2142190..2142253	-	64	NuclAT_20	-	-
-	2142190..2142253	-	64	NuclAT_20	-	-
-	2142190..2142253	-	64	NuclAT_20	-	-
-	2142190..2142253	-	64	NuclAT_20	-	-
-	2142190..2142253	-	64	NuclAT_23	-	-
-	2142190..2142253	-	64	NuclAT_23	-	-
-	2142190..2142253	-	64	NuclAT_23	-	-
-	2142190..2142253	-	64	NuclAT_23	-	-
-	2142190..2142253	-	64	NuclAT_26	-	-
-	2142190..2142253	-	64	NuclAT_26	-	-
-	2142190..2142253	-	64	NuclAT_26	-	-
-	2142190..2142253	-	64	NuclAT_26	-	-
-	2142190..2142253	-	64	NuclAT_29	-	-
-	2142190..2142253	-	64	NuclAT_29	-	-
-	2142190..2142253	-	64	NuclAT_29	-	-
-	2142190..2142253	-	64	NuclAT_29	-	-
-	2142190..2142253	-	64	NuclAT_32	-	-
-	2142190..2142253	-	64	NuclAT_32	-	-
-	2142190..2142253	-	64	NuclAT_32	-	-
-	2142190..2142253	-	64	NuclAT_32	-	-
F7D02_RS10780	2142303..2142410	+	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
F7D02_RS10785	2142559..2143413	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
F7D02_RS10790	2143449..2144258	-	810	WP_001257044.1	invasion regulator SirB1	-
F7D02_RS10795	2144262..2144654	-	393	WP_000200392.1	invasion regulator SirB2	-
F7D02_RS10800	2144651..2145484	-	834	WP_000456459.1	peptide chain release factor N(5)-glutamine methyltransferase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4001.77 Da
• Isoelectric Point: 11.4779

>T140670 WP_000170965.1 NZ_CP044315:2141232-2141339 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T140670 NZ_CP059331:796429-796818 [Mannheimia haemolytica]
ATGTATATGTTAGATACGAATACTGTAAGCTAATTTTTTCGTGGAAATGCAAATGTGGTGGCGAAATTGAAGTCCATTAA
TCCTGAGAGGCTTTGTATTTCATCTGTAACTGCTGCTGAATTGGTTTATGGTGTGGCGAAAAGAAATAATGGGCAGCTTT
CTCAATTTTTAGGTTATTTTTTATCGAGTGTAAAGGTTTTAGATTGGAATTATCGTTGTGCTGAACTTTATGGAAAGTTA
CGGGCAGAGATGGAGAAAAATGGCAAAGTAATGGGCGTGCAGGATCAAATGATTGCTAGTCACGCTCTTGCTGAAGAGTG
TATTTTAGTTTCTAGCGATCAGGCATTTAAAATGGTACCTGATCTGAAATTGGAGAATTGGTTACACTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT140670 NZ_CP044315:c2141185-2141119 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A0E0Y029

Antitoxin