Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4253973..4254194 Replicon chromosome
Accession NZ_CP044293
Organism Escherichia coli strain P276M

Toxin (Protein)


Gene name ldrD Uniprot ID E3PKK3
Locus tag F6P95_RS20530 Protein ID WP_000170951.1
Coordinates 4253973..4254080 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4254128..4254194 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
F6P95_RS20505 4249819..4250901 + 1083 WP_000804726.1 peptide chain release factor 1 -
F6P95_RS20510 4250901..4251734 + 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
F6P95_RS20515 4251731..4252123 + 393 WP_000200373.1 invasion regulator SirB2 -
F6P95_RS20520 4252127..4252936 + 810 WP_001257044.1 invasion regulator SirB1 -
F6P95_RS20525 4252972..4253826 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
F6P95_RS20530 4253973..4254080 - 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4254128..4254194 + 67 NuclAT_15 - Antitoxin
- 4254128..4254194 + 67 NuclAT_15 - Antitoxin
- 4254128..4254194 + 67 NuclAT_15 - Antitoxin
- 4254128..4254194 + 67 NuclAT_15 - Antitoxin
- 4254128..4254194 + 67 NuclAT_17 - Antitoxin
- 4254128..4254194 + 67 NuclAT_17 - Antitoxin
- 4254128..4254194 + 67 NuclAT_17 - Antitoxin
- 4254128..4254194 + 67 NuclAT_17 - Antitoxin
- 4254128..4254194 + 67 NuclAT_19 - Antitoxin
- 4254128..4254194 + 67 NuclAT_19 - Antitoxin
- 4254128..4254194 + 67 NuclAT_19 - Antitoxin
- 4254128..4254194 + 67 NuclAT_19 - Antitoxin
- 4254128..4254194 + 67 NuclAT_21 - Antitoxin
- 4254128..4254194 + 67 NuclAT_21 - Antitoxin
- 4254128..4254194 + 67 NuclAT_21 - Antitoxin
- 4254128..4254194 + 67 NuclAT_21 - Antitoxin
- 4254128..4254194 + 67 NuclAT_23 - Antitoxin
- 4254128..4254194 + 67 NuclAT_23 - Antitoxin
- 4254128..4254194 + 67 NuclAT_23 - Antitoxin
- 4254128..4254194 + 67 NuclAT_23 - Antitoxin
- 4254128..4254194 + 67 NuclAT_25 - Antitoxin
- 4254128..4254194 + 67 NuclAT_25 - Antitoxin
- 4254128..4254194 + 67 NuclAT_25 - Antitoxin
- 4254128..4254194 + 67 NuclAT_25 - Antitoxin
- 4254130..4254193 + 64 NuclAT_29 - -
- 4254130..4254193 + 64 NuclAT_29 - -
- 4254130..4254193 + 64 NuclAT_29 - -
- 4254130..4254193 + 64 NuclAT_29 - -
- 4254130..4254193 + 64 NuclAT_31 - -
- 4254130..4254193 + 64 NuclAT_31 - -
- 4254130..4254193 + 64 NuclAT_31 - -
- 4254130..4254193 + 64 NuclAT_31 - -
- 4254130..4254193 + 64 NuclAT_33 - -
- 4254130..4254193 + 64 NuclAT_33 - -
- 4254130..4254193 + 64 NuclAT_33 - -
- 4254130..4254193 + 64 NuclAT_33 - -
- 4254130..4254193 + 64 NuclAT_35 - -
- 4254130..4254193 + 64 NuclAT_35 - -
- 4254130..4254193 + 64 NuclAT_35 - -
- 4254130..4254193 + 64 NuclAT_35 - -
- 4254130..4254193 + 64 NuclAT_38 - -
- 4254130..4254193 + 64 NuclAT_38 - -
- 4254130..4254193 + 64 NuclAT_38 - -
- 4254130..4254193 + 64 NuclAT_38 - -
- 4254130..4254193 + 64 NuclAT_40 - -
- 4254130..4254193 + 64 NuclAT_40 - -
- 4254130..4254193 + 64 NuclAT_40 - -
- 4254130..4254193 + 64 NuclAT_40 - -
F6P95_RS20535 4254508..4254615 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 4254663..4254728 + 66 NuclAT_28 - -
- 4254663..4254728 + 66 NuclAT_28 - -
- 4254663..4254728 + 66 NuclAT_28 - -
- 4254663..4254728 + 66 NuclAT_28 - -
- 4254663..4254728 + 66 NuclAT_30 - -
- 4254663..4254728 + 66 NuclAT_30 - -
- 4254663..4254728 + 66 NuclAT_30 - -
- 4254663..4254728 + 66 NuclAT_30 - -
- 4254663..4254728 + 66 NuclAT_32 - -
- 4254663..4254728 + 66 NuclAT_32 - -
- 4254663..4254728 + 66 NuclAT_32 - -
- 4254663..4254728 + 66 NuclAT_32 - -
- 4254663..4254728 + 66 NuclAT_34 - -
- 4254663..4254728 + 66 NuclAT_34 - -
- 4254663..4254728 + 66 NuclAT_34 - -
- 4254663..4254728 + 66 NuclAT_34 - -
- 4254663..4254728 + 66 NuclAT_37 - -
- 4254663..4254728 + 66 NuclAT_37 - -
- 4254663..4254728 + 66 NuclAT_37 - -
- 4254663..4254728 + 66 NuclAT_37 - -
- 4254663..4254728 + 66 NuclAT_39 - -
- 4254663..4254728 + 66 NuclAT_39 - -
- 4254663..4254728 + 66 NuclAT_39 - -
- 4254663..4254728 + 66 NuclAT_39 - -
- 4254664..4254729 + 66 NuclAT_16 - -
- 4254664..4254729 + 66 NuclAT_16 - -
- 4254664..4254729 + 66 NuclAT_16 - -
- 4254664..4254729 + 66 NuclAT_16 - -
- 4254664..4254729 + 66 NuclAT_18 - -
- 4254664..4254729 + 66 NuclAT_18 - -
- 4254664..4254729 + 66 NuclAT_18 - -
- 4254664..4254729 + 66 NuclAT_18 - -
- 4254664..4254729 + 66 NuclAT_20 - -
- 4254664..4254729 + 66 NuclAT_20 - -
- 4254664..4254729 + 66 NuclAT_20 - -
- 4254664..4254729 + 66 NuclAT_20 - -
- 4254664..4254729 + 66 NuclAT_22 - -
- 4254664..4254729 + 66 NuclAT_22 - -
- 4254664..4254729 + 66 NuclAT_22 - -
- 4254664..4254729 + 66 NuclAT_22 - -
- 4254664..4254729 + 66 NuclAT_24 - -
- 4254664..4254729 + 66 NuclAT_24 - -
- 4254664..4254729 + 66 NuclAT_24 - -
- 4254664..4254729 + 66 NuclAT_24 - -
- 4254664..4254729 + 66 NuclAT_26 - -
- 4254664..4254729 + 66 NuclAT_26 - -
- 4254664..4254729 + 66 NuclAT_26 - -
- 4254664..4254729 + 66 NuclAT_26 - -
F6P95_RS20540 4255020..4256120 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
F6P95_RS20545 4256390..4256620 + 231 WP_001146444.1 putative cation transport regulator ChaB -
F6P95_RS20550 4256778..4257473 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
F6P95_RS20555 4257517..4257870 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3961.74 Da        Isoelectric Point: 9.1413

>T140539 WP_000170951.1 NZ_CP044293:c4254080-4253973 [Escherichia coli]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T140539 NZ_CP059296:129083-129526 [Klebsiella pneumoniae]
ATGAAGAAAACCTGGATGCTCGACACTAACATCTGCTCGTTCATCATGCGCGAGCAGCCGGCAGCGGTGCTGAAGCGCCT
GGAACAGGCGGTGCTGCGCGGTGATCGCATCGTGGTCTCGGCCGTGACGTATGCCGAGATGCGCTTCGGCGCCACCGGCC
CGAAGGCCTCGCCGCGCCATATTCAGCTGGTCGACGCGTTCTGCGCGCGCCTCGATGCCATCCTGCCCTGGGACCGGGCC
GCGGTGGACGCCACGACGGACATCCGGGTGGCGCTGCGCCTCGCCGGGACGCCGATCGGCCCGAACGACACGGCCATTGC
TGGGCACGCTATCGCGGCCGGCGCCGTCCTAGTGACGAACAATGTGAGAGAGTTTGAGCGGGTGCCGGGTCTGGTGCTGG
AAGACTGGGTGAAGAAAGCCGCTCTCTGCAGGGTAATTTCTTGA

Antitoxin


Download         Length: 67 bp

>AT140539 NZ_CP044293:4254128-4254194 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB E3PKK3

Antitoxin

Download structure file

References