Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 4253973..4254194 | Replicon | chromosome |
| Accession | NZ_CP044293 | ||
| Organism | Escherichia coli strain P276M | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | E3PKK3 |
| Locus tag | F6P95_RS20530 | Protein ID | WP_000170951.1 |
| Coordinates | 4253973..4254080 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4254128..4254194 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F6P95_RS20505 | 4249819..4250901 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| F6P95_RS20510 | 4250901..4251734 | + | 834 | WP_000456454.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| F6P95_RS20515 | 4251731..4252123 | + | 393 | WP_000200373.1 | invasion regulator SirB2 | - |
| F6P95_RS20520 | 4252127..4252936 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| F6P95_RS20525 | 4252972..4253826 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| F6P95_RS20530 | 4253973..4254080 | - | 108 | WP_000170951.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4254128..4254194 | + | 67 | NuclAT_15 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_15 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_15 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_15 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_23 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_23 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_23 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_23 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_25 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_25 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_25 | - | Antitoxin |
| - | 4254128..4254194 | + | 67 | NuclAT_25 | - | Antitoxin |
| - | 4254130..4254193 | + | 64 | NuclAT_29 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_29 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_29 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_29 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_31 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_31 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_31 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_31 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_33 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_33 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_33 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_33 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_35 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_35 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_35 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_35 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_38 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_38 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_38 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_38 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_40 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_40 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_40 | - | - |
| - | 4254130..4254193 | + | 64 | NuclAT_40 | - | - |
| F6P95_RS20535 | 4254508..4254615 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | - |
| - | 4254663..4254728 | + | 66 | NuclAT_28 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_28 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_28 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_28 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_30 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_30 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_30 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_30 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_32 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_32 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_32 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_32 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_34 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_34 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_34 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_34 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_37 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_37 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_37 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_37 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_39 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_39 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_39 | - | - |
| - | 4254663..4254728 | + | 66 | NuclAT_39 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_16 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_16 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_16 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_16 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_18 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_18 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_18 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_18 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_20 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_20 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_20 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_20 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_22 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_22 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_22 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_22 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_24 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_24 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_24 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_24 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_26 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_26 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_26 | - | - |
| - | 4254664..4254729 | + | 66 | NuclAT_26 | - | - |
| F6P95_RS20540 | 4255020..4256120 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| F6P95_RS20545 | 4256390..4256620 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| F6P95_RS20550 | 4256778..4257473 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| F6P95_RS20555 | 4257517..4257870 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3961.74 Da Isoelectric Point: 9.1413
>T140539 WP_000170951.1 NZ_CP044293:c4254080-4253973 [Escherichia coli]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T140539 NZ_CP059296:129083-129526 [Klebsiella pneumoniae]
ATGAAGAAAACCTGGATGCTCGACACTAACATCTGCTCGTTCATCATGCGCGAGCAGCCGGCAGCGGTGCTGAAGCGCCT
GGAACAGGCGGTGCTGCGCGGTGATCGCATCGTGGTCTCGGCCGTGACGTATGCCGAGATGCGCTTCGGCGCCACCGGCC
CGAAGGCCTCGCCGCGCCATATTCAGCTGGTCGACGCGTTCTGCGCGCGCCTCGATGCCATCCTGCCCTGGGACCGGGCC
GCGGTGGACGCCACGACGGACATCCGGGTGGCGCTGCGCCTCGCCGGGACGCCGATCGGCCCGAACGACACGGCCATTGC
TGGGCACGCTATCGCGGCCGGCGCCGTCCTAGTGACGAACAATGTGAGAGAGTTTGAGCGGGTGCCGGGTCTGGTGCTGG
AAGACTGGGTGAAGAAAGCCGCTCTCTGCAGGGTAATTTCTTGA
ATGAAGAAAACCTGGATGCTCGACACTAACATCTGCTCGTTCATCATGCGCGAGCAGCCGGCAGCGGTGCTGAAGCGCCT
GGAACAGGCGGTGCTGCGCGGTGATCGCATCGTGGTCTCGGCCGTGACGTATGCCGAGATGCGCTTCGGCGCCACCGGCC
CGAAGGCCTCGCCGCGCCATATTCAGCTGGTCGACGCGTTCTGCGCGCGCCTCGATGCCATCCTGCCCTGGGACCGGGCC
GCGGTGGACGCCACGACGGACATCCGGGTGGCGCTGCGCCTCGCCGGGACGCCGATCGGCCCGAACGACACGGCCATTGC
TGGGCACGCTATCGCGGCCGGCGCCGTCCTAGTGACGAACAATGTGAGAGAGTTTGAGCGGGTGCCGGGTCTGGTGCTGG
AAGACTGGGTGAAGAAAGCCGCTCTCTGCAGGGTAATTTCTTGA
Antitoxin
Download Length: 67 bp
>AT140539 NZ_CP044293:4254128-4254194 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|