Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 143326..143579 | Replicon | plasmid pKPC-2-KP65 |
Accession | NZ_CP044259 | ||
Organism | Klebsiella pneumoniae strain KP65 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | F6W81_RS28270 | Protein ID | WP_001312851.1 |
Coordinates | 143430..143579 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 143326..143385 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F6W81_RS28225 | 138986..139051 | - | 66 | Protein_188 | helix-turn-helix domain-containing protein | - |
F6W81_RS28230 | 139104..139808 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
F6W81_RS28235 | 139872..140033 | + | 162 | Protein_190 | DNA helicase | - |
F6W81_RS28240 | 140053..140799 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
F6W81_RS28245 | 140854..141414 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
F6W81_RS28250 | 141546..141746 | + | 201 | WP_015059022.1 | hypothetical protein | - |
F6W81_RS28255 | 142132..142731 | + | 600 | WP_032083981.1 | hypothetical protein | - |
F6W81_RS28260 | 142895..143125 | + | 231 | WP_001736714.1 | hypothetical protein | - |
- | 143326..143385 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 143326..143385 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 143326..143385 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 143326..143385 | - | 60 | NuclAT_1 | - | Antitoxin |
F6W81_RS28270 | 143430..143579 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
F6W81_RS28275 | 143863..144111 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 | - | 1..144422 | 144422 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T140505 WP_001312851.1 NZ_CP044259:143430-143579 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T140505 NZ_CP059285:c73889-73731 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 60 bp
>AT140505 NZ_CP044259:c143385-143326 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|