Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 80473..80743 | Replicon | plasmid pKPC-2-KP65 |
| Accession | NZ_CP044259 | ||
| Organism | Klebsiella pneumoniae strain KP65 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | F6W81_RS27800 | Protein ID | WP_001312861.1 |
| Coordinates | 80585..80743 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 80473..80536 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F6W81_RS27775 | 76184..76711 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| F6W81_RS27780 | 76769..77002 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| F6W81_RS27785 | 77063..79086 | + | 2024 | Protein_106 | ParB/RepB/Spo0J family partition protein | - |
| F6W81_RS27790 | 79155..79589 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| F6W81_RS27795 | 79586..80305 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 80317..80541 | + | 225 | NuclAT_0 | - | - |
| - | 80317..80541 | + | 225 | NuclAT_0 | - | - |
| - | 80317..80541 | + | 225 | NuclAT_0 | - | - |
| - | 80317..80541 | + | 225 | NuclAT_0 | - | - |
| - | 80473..80536 | - | 64 | - | - | Antitoxin |
| F6W81_RS27800 | 80585..80743 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| F6W81_RS28945 | 80981..81358 | - | 378 | Protein_110 | hypothetical protein | - |
| F6W81_RS27820 | 81658..81954 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| F6W81_RS27825 | 82065..82886 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| F6W81_RS27830 | 83183..83830 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| F6W81_RS27835 | 84107..84490 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
| F6W81_RS27840 | 84681..85367 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| F6W81_RS27845 | 85461..85688 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 | - | 1..144422 | 144422 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T140500 WP_001312861.1 NZ_CP044259:80585-80743 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T140500 NZ_CP059283:3474058-3474276 [Escherichia coli]
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA
Antitoxin
Download Length: 64 bp
>AT140500 NZ_CP044259:c80536-80473 [Klebsiella pneumoniae]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|