Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2366176..2366401 | Replicon | chromosome |
Accession | NZ_CP044158 | ||
Organism | Shigella flexneri strain AR-0423 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | F4V35_RS12475 | Protein ID | WP_000813254.1 |
Coordinates | 2366176..2366331 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2366343..2366401 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F4V35_RS12410 | 2361488..2361838 | - | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
F4V35_RS12415 | 2361835..2362509 | - | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
F4V35_RS12420 | 2362608..2362823 | - | 216 | WP_000839572.1 | class II holin family protein | - |
F4V35_RS12450 | 2363619..2364307 | - | 689 | Protein_2400 | bacteriophage antitermination protein Q | - |
F4V35_RS12455 | 2364304..2364669 | - | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
F4V35_RS12460 | 2364670..2365728 | - | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
F4V35_RS12465 | 2365730..2366008 | - | 279 | WP_011069426.1 | hypothetical protein | - |
F4V35_RS12475 | 2366176..2366331 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 2366343..2366401 | + | 59 | - | - | Antitoxin |
F4V35_RS12490 | 2366983..2367399 | - | 417 | WP_005069274.1 | hypothetical protein | - |
F4V35_RS12495 | 2367426..2367566 | + | 141 | Protein_2406 | DUF4224 domain-containing protein | - |
F4V35_RS12500 | 2367566..2368616 | + | 1051 | Protein_2407 | tyrosine-type recombinase/integrase | - |
F4V35_RS12510 | 2368827..2369624 | + | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
F4V35_RS12520 | 2369962..2371224 | + | 1263 | Protein_2409 | tyrosine-type recombinase/integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 2333549..2373991 | 40442 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T140414 WP_000813254.1 NZ_CP044158:c2366331-2366176 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T140414 NZ_CP059156:c2068711-2068535 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 59 bp
>AT140414 NZ_CP044158:2366343-2366401 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|