Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1558896..1559116 | Replicon | chromosome |
Accession | NZ_CP044158 | ||
Organism | Shigella flexneri strain AR-0423 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A4P7TT65 |
Locus tag | F4V35_RS07985 | Protein ID | WP_000170961.1 |
Coordinates | 1558896..1559003 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1559050..1559116 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F4V35_RS07960 | 1554740..1555822 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
F4V35_RS07965 | 1555822..1556655 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
F4V35_RS07970 | 1556652..1557044 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
F4V35_RS07975 | 1557048..1557857 | + | 810 | WP_001257042.1 | invasion regulator SirB1 | - |
F4V35_RS07980 | 1557893..1558747 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
F4V35_RS07985 | 1558896..1559003 | - | 108 | WP_000170961.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 1559050..1559116 | + | 67 | - | - | Antitoxin |
F4V35_RS07995 | 1559408..1560508 | - | 1101 | WP_000063614.1 | sodium-potassium/proton antiporter ChaA | - |
F4V35_RS08000 | 1560778..1561008 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
F4V35_RS08005 | 1561166..1561861 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
F4V35_RS08010 | 1561905..1562258 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
F4V35_RS08015 | 1562443..1563837 | + | 1395 | WP_000086222.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T140401 WP_000170961.1 NZ_CP044158:c1559003-1558896 [Shigella flexneri]
MTLAQFAMTFWHDLAAPILAGIIAAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIIAAAIVSWWRNRK
Download Length: 108 bp
>T140401 NZ_CP059155:c2092960-2092784 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 67 bp
>AT140401 NZ_CP044158:1559050-1559116 [Shigella flexneri]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|