Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 448529..448754 | Replicon | chromosome |
Accession | NZ_CP044152 | ||
Organism | Shigella flexneri strain AR-0425 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | F4V37_RS02440 | Protein ID | WP_000813254.1 |
Coordinates | 448529..448684 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 448696..448754 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F4V37_RS02400 | 443655..444137 | - | 483 | WP_000068107.1 | ORF6N domain-containing protein | - |
F4V37_RS02410 | 445426..445599 | - | 174 | WP_000504450.1 | hypothetical protein | - |
F4V37_RS02415 | 445752..446306 | - | 555 | WP_000640143.1 | DUF1133 family protein | - |
F4V37_RS02420 | 446303..446593 | - | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
F4V37_RS02425 | 446593..447192 | - | 600 | WP_000940329.1 | DUF1367 family protein | - |
F4V37_RS02430 | 447326..448023 | + | 698 | WP_223368647.1 | IS1 family transposase | - |
F4V37_RS02440 | 448529..448684 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 448696..448754 | + | 59 | - | - | Antitoxin |
F4V37_RS02445 | 449139..449504 | - | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
F4V37_RS02450 | 449504..450169 | - | 666 | WP_000208062.1 | hypothetical protein | - |
F4V37_RS02455 | 450166..450531 | - | 366 | WP_001229297.1 | HNH endonuclease signature motif containing protein | - |
F4V37_RS02460 | 450533..450751 | - | 219 | WP_000256998.1 | DUF4014 family protein | - |
F4V37_RS02465 | 450844..451200 | - | 357 | WP_005048249.1 | hypothetical protein | - |
F4V37_RS02470 | 451258..451680 | - | 423 | WP_001118168.1 | DUF977 family protein | - |
F4V37_RS02475 | 451695..452441 | - | 747 | WP_000788996.1 | ATP-binding protein | - |
F4V37_RS25295 | 452587..452756 | - | 170 | Protein_477 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | sitABCD | ipaH9.8 | 397305..456671 | 59366 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T140347 WP_000813254.1 NZ_CP044152:c448684-448529 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T140347 NZ_CP059125:296327-296500 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 59 bp
>AT140347 NZ_CP044152:448696-448754 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|