Detailed information of TA system TA140311

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 5405426..5405640
• Replicon: chromosome
• Accession: NZ_CP044148
• Organism: Escherichia coli O157 strain AR-0427

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: F4V39_RS27460
• Protein ID: WP_000170963.1
• Coordinates: 5405426..5405533 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	5405581..5405640 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
F4V39_RS27425	5400735..5401817	+	1083	WP_000804726.1	peptide chain release factor 1	-
F4V39_RS27430	5401817..5402650	+	834	WP_000456466.1	peptide chain release factor N(5)-glutamine methyltransferase	-
F4V39_RS27435	5402647..5403039	+	393	WP_000200379.1	invasion regulator SirB2	-
F4V39_RS27440	5403043..5403852	+	810	WP_001257044.1	invasion regulator SirB1	-
F4V39_RS27445	5403888..5404742	+	855	WP_000811067.1	3-deoxy-8-phosphooctulonate synthase	-
F4V39_RS27450	5404890..5404997	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	5405050..5405111	+	62	NuclAT_24	-	-
-	5405050..5405111	+	62	NuclAT_24	-	-
-	5405050..5405111	+	62	NuclAT_24	-	-
-	5405050..5405111	+	62	NuclAT_24	-	-
-	5405050..5405111	+	62	NuclAT_26	-	-
-	5405050..5405111	+	62	NuclAT_26	-	-
-	5405050..5405111	+	62	NuclAT_26	-	-
-	5405050..5405111	+	62	NuclAT_26	-	-
-	5405050..5405111	+	62	NuclAT_28	-	-
-	5405050..5405111	+	62	NuclAT_28	-	-
-	5405050..5405111	+	62	NuclAT_28	-	-
-	5405050..5405111	+	62	NuclAT_28	-	-
-	5405050..5405111	+	62	NuclAT_30	-	-
-	5405050..5405111	+	62	NuclAT_30	-	-
-	5405050..5405111	+	62	NuclAT_30	-	-
-	5405050..5405111	+	62	NuclAT_30	-	-
-	5405050..5405111	+	62	NuclAT_32	-	-
-	5405050..5405111	+	62	NuclAT_32	-	-
-	5405050..5405111	+	62	NuclAT_32	-	-
-	5405050..5405111	+	62	NuclAT_32	-	-
-	5405050..5405112	+	63	NuclAT_17	-	-
-	5405050..5405112	+	63	NuclAT_17	-	-
-	5405050..5405112	+	63	NuclAT_17	-	-
-	5405050..5405112	+	63	NuclAT_17	-	-
-	5405050..5405112	+	63	NuclAT_18	-	-
-	5405050..5405112	+	63	NuclAT_18	-	-
-	5405050..5405112	+	63	NuclAT_18	-	-
-	5405050..5405112	+	63	NuclAT_18	-	-
-	5405050..5405112	+	63	NuclAT_19	-	-
-	5405050..5405112	+	63	NuclAT_19	-	-
-	5405050..5405112	+	63	NuclAT_19	-	-
-	5405050..5405112	+	63	NuclAT_19	-	-
-	5405050..5405112	+	63	NuclAT_20	-	-
-	5405050..5405112	+	63	NuclAT_20	-	-
-	5405050..5405112	+	63	NuclAT_20	-	-
-	5405050..5405112	+	63	NuclAT_20	-	-
-	5405050..5405112	+	63	NuclAT_22	-	-
-	5405050..5405112	+	63	NuclAT_22	-	-
-	5405050..5405112	+	63	NuclAT_22	-	-
-	5405050..5405112	+	63	NuclAT_22	-	-
-	5405050..5405112	+	63	NuclAT_23	-	-
-	5405050..5405112	+	63	NuclAT_23	-	-
-	5405050..5405112	+	63	NuclAT_23	-	-
-	5405050..5405112	+	63	NuclAT_23	-	-
F4V39_RS27460	5405426..5405533	-	108	WP_000170963.1	small toxic polypeptide LdrB	Toxin
-	5405581..5405640	+	60	NuclAT_25	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_25	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_25	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_25	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_27	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_27	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_27	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_27	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_29	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_29	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_29	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_29	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_31	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_31	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_31	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_31	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_33	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_33	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_33	-	Antitoxin
-	5405581..5405640	+	60	NuclAT_33	-	Antitoxin
F4V39_RS27470	5405932..5407032	-	1101	WP_001301956.1	sodium-potassium/proton antiporter ChaA	-
F4V39_RS27475	5407302..5407532	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
F4V39_RS27480	5407693..5408388	+	696	WP_001453713.1	glutathione-specific gamma-glutamylcyclotransferase	-
F4V39_RS27485	5408432..5408785	-	354	WP_001169661.1	DsrE/F sulfur relay family protein YchN	-
F4V39_RS27490	5408971..5410365	+	1395	WP_000086192.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T140311 WP_000170963.1 NZ_CP044148:c5405533-5405426 [Escherichia coli O157]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T140311 NZ_CP059089:c1432165-1431749 [Pantoea agglomerans]
GTGAACAAGACCTATATGCTCGACACTAATATTTGCTCATTTATTATGCGTGAGCAGCCTGAAGAGGTCATCCGGCGACT
GGAACAGGCGGTGCTGCGCAACCACCGGATTGTGGTATCTGCAATTACTTATGCTGAAATGCGTTTCGGTGCAATCGGAA
AGAAAGCTTCACCACGGCATATACAATTGGTGGATGCATTCTGCGCACGTCTTGATGCTGTGCTTTCATGGGATCGCGCA
GCGGCAGATGCAACTACTGAAATCAAAGCGGCGCTGGCTGCTGCCGGAACGCCCATGGATCCCAGCGACACCGCGATTGC
CGGGCATGCCATTGCGGCCAGGGCTATTCTGGTGACCAATAACACACGTGAGTTTGAACGGGTACCCGGATTGCAGCTGG
AAGAGTGGGTCAGCTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT140311 NZ_CP044148:5405581-5405640 [Escherichia coli O157]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin