Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 301896..302121 | Replicon | chromosome |
Accession | NZ_CP044148 | ||
Organism | Escherichia coli O157 strain AR-0427 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | F4V39_RS01430 | Protein ID | WP_000813258.1 |
Coordinates | 301896..302051 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 302063..302121 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F4V39_RS01380 | 296900..297331 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
F4V39_RS01395 | 297782..298495 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
F4V39_RS01400 | 298630..298827 | - | 198 | WP_000917763.1 | hypothetical protein | - |
F4V39_RS01405 | 299052..299606 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
F4V39_RS01410 | 299669..299974 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
F4V39_RS01415 | 299987..301036 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
F4V39_RS01420 | 301038..301310 | - | 273 | WP_000191871.1 | hypothetical protein | - |
F4V39_RS01425 | 301432..301776 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
F4V39_RS01430 | 301896..302051 | - | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 302063..302121 | + | 59 | - | - | Antitoxin |
F4V39_RS01435 | 302342..302899 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
F4V39_RS01440 | 302901..303119 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
F4V39_RS01445 | 303247..303558 | - | 312 | WP_001289673.1 | hypothetical protein | - |
F4V39_RS01450 | 303551..303778 | - | 228 | WP_000699809.1 | hypothetical protein | - |
F4V39_RS01455 | 303775..304056 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
F4V39_RS01460 | 304089..304805 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
F4V39_RS01465 | 304839..305300 | - | 462 | WP_000139447.1 | replication protein | - |
F4V39_RS01470 | 305293..306348 | - | 1056 | WP_001356791.1 | hypothetical protein | - |
F4V39_RS01475 | 306417..306842 | - | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
F4V39_RS01480 | 306826..307069 | - | 244 | Protein_290 | Cro/Cl family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' | 264451..369203 | 104752 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T140275 WP_000813258.1 NZ_CP044148:c302051-301896 [Escherichia coli O157]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T140275 NZ_CP059068:4487730-4487984 [Rhodoferax sp. AJA081-3]
ATGAAGGTCGTAACCTATTCCGAAGCCCGCAGCGCACTGAAAACAGTGCTGGATCGCGTGCATGACGATGCAGACGTGAC
GGTCATCAGCCGTCGCGATGGGGCTGATGCAGTCGTCATGTCGTTGGAGCACTACCAAAGCATCATGGAAACCATGCACC
TGCTTGGCACACCTGCAAATGCTGCGCATCTGGCCAAGTCCATTGCACAGCACAAAGCCGGCAAGGCCGTGCGGCGCAAG
TTGGTCCCAGCCTGA
ATGAAGGTCGTAACCTATTCCGAAGCCCGCAGCGCACTGAAAACAGTGCTGGATCGCGTGCATGACGATGCAGACGTGAC
GGTCATCAGCCGTCGCGATGGGGCTGATGCAGTCGTCATGTCGTTGGAGCACTACCAAAGCATCATGGAAACCATGCACC
TGCTTGGCACACCTGCAAATGCTGCGCATCTGGCCAAGTCCATTGCACAGCACAAAGCCGGCAAGGCCGTGCGGCGCAAG
TTGGTCCCAGCCTGA
Antitoxin
Download Length: 59 bp
>AT140275 NZ_CP044148:302063-302121 [Escherichia coli O157]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|