Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 1861031..1861443 | Replicon | chromosome |
Accession | NZ_CP044143 | ||
Organism | Escherichia coli O157 strain AR-0429 |
Toxin (Protein)
Gene name | symE | Uniprot ID | Q8FA88 |
Locus tag | F4V41_RS10500 | Protein ID | WP_000132630.1 |
Coordinates | 1861102..1861443 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 1861031..1861107 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F4V41_RS10490 | 1857658..1859127 | + | 1470 | WP_001302468.1 | type I restriction-modification system subunit M | - |
F4V41_RS10495 | 1859127..1860881 | + | 1755 | WP_000110082.1 | restriction endonuclease subunit S | - |
- | 1861031..1861107 | - | 77 | NuclAT_15 | - | Antitoxin |
- | 1861031..1861107 | - | 77 | NuclAT_15 | - | Antitoxin |
- | 1861031..1861107 | - | 77 | NuclAT_15 | - | Antitoxin |
- | 1861031..1861107 | - | 77 | NuclAT_15 | - | Antitoxin |
- | 1861031..1861107 | - | 77 | NuclAT_16 | - | Antitoxin |
- | 1861031..1861107 | - | 77 | NuclAT_16 | - | Antitoxin |
- | 1861031..1861107 | - | 77 | NuclAT_16 | - | Antitoxin |
- | 1861031..1861107 | - | 77 | NuclAT_16 | - | Antitoxin |
F4V41_RS10500 | 1861102..1861443 | + | 342 | WP_000132630.1 | endoribonuclease SymE | Toxin |
F4V41_RS10505 | 1861490..1862653 | - | 1164 | WP_001304006.1 | DUF1524 domain-containing protein | - |
F4V41_RS10510 | 1862701..1863582 | - | 882 | WP_001304007.1 | DUF262 domain-containing protein | - |
F4V41_RS10515 | 1863679..1863843 | - | 165 | WP_000394274.1 | DUF1127 domain-containing protein | - |
F4V41_RS10520 | 1864020..1865432 | + | 1413 | WP_000199295.1 | PLP-dependent aminotransferase family protein | - |
F4V41_RS29415 | 1865675..1865875 | - | 201 | WP_001310455.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | espX6 | 1853230..1874463 | 21233 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12294.13 Da Isoelectric Point: 8.4982
>T140214 WP_000132630.1 NZ_CP044143:1861102-1861443 [Escherichia coli O157]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
>T140214 NZ_CP059043:c1703242-1703135 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 77 bp
>AT140214 NZ_CP044143:c1861107-1861031 [Escherichia coli O157]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|