Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 4922518..4922740 | Replicon | chromosome |
| Accession | NZ_CP043950 | ||
| Organism | Escherichia coli strain ST95-32 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | F3J96_RS24530 | Protein ID | WP_001295224.1 |
| Coordinates | 4922518..4922625 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4922682..4922740 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F3J96_RS24495 | 4917572..4917760 | - | 189 | WP_001063314.1 | YhjR family protein | - |
| F3J96_RS24500 | 4918033..4919604 | + | 1572 | WP_001204957.1 | cellulose biosynthesis protein BcsE | - |
| F3J96_RS24505 | 4919601..4919792 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| F3J96_RS24510 | 4919789..4921468 | + | 1680 | WP_000191567.1 | cellulose biosynthesis protein BcsG | - |
| F3J96_RS24515 | 4921554..4921661 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| F3J96_RS24520 | 4922036..4922143 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| F3J96_RS24530 | 4922518..4922625 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4922682..4922740 | + | 59 | - | - | Antitoxin |
| F3J96_RS24540 | 4923000..4923107 | - | 108 | WP_000170745.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| F3J96_RS24550 | 4923583..4924854 | + | 1272 | WP_001332306.1 | amino acid permease | - |
| F3J96_RS24555 | 4924884..4925888 | - | 1005 | WP_000103579.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| F3J96_RS24560 | 4925885..4926868 | - | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T139658 WP_001295224.1 NZ_CP043950:c4922625-4922518 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T139658 NZ_CP058771:c2103935-2103828 [Shigella flexneri]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT139658 NZ_CP043950:4922682-4922740 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|