Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2282800..2283021 Replicon chromosome
Accession NZ_CP043950
Organism Escherichia coli strain ST95-32

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag F3J96_RS11355 Protein ID WP_000170954.1
Coordinates 2282800..2282907 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2282960..2283021 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
F3J96_RS11330 2278645..2279727 + 1083 WP_000804726.1 peptide chain release factor 1 -
F3J96_RS11335 2279727..2280560 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
F3J96_RS11340 2280557..2280949 + 393 WP_000200375.1 invasion regulator SirB2 -
F3J96_RS11345 2280953..2281762 + 810 WP_001257054.1 invasion regulator SirB1 -
F3J96_RS11350 2281798..2282652 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
F3J96_RS11355 2282800..2282907 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2282960..2283021 + 62 NuclAT_14 - Antitoxin
- 2282960..2283021 + 62 NuclAT_14 - Antitoxin
- 2282960..2283021 + 62 NuclAT_14 - Antitoxin
- 2282960..2283021 + 62 NuclAT_14 - Antitoxin
- 2282960..2283021 + 62 NuclAT_15 - Antitoxin
- 2282960..2283021 + 62 NuclAT_15 - Antitoxin
- 2282960..2283021 + 62 NuclAT_15 - Antitoxin
- 2282960..2283021 + 62 NuclAT_15 - Antitoxin
- 2282960..2283021 + 62 NuclAT_16 - Antitoxin
- 2282960..2283021 + 62 NuclAT_16 - Antitoxin
- 2282960..2283021 + 62 NuclAT_16 - Antitoxin
- 2282960..2283021 + 62 NuclAT_16 - Antitoxin
- 2282960..2283021 + 62 NuclAT_17 - Antitoxin
- 2282960..2283021 + 62 NuclAT_17 - Antitoxin
- 2282960..2283021 + 62 NuclAT_17 - Antitoxin
- 2282960..2283021 + 62 NuclAT_17 - Antitoxin
- 2282960..2283021 + 62 NuclAT_18 - Antitoxin
- 2282960..2283021 + 62 NuclAT_18 - Antitoxin
- 2282960..2283021 + 62 NuclAT_18 - Antitoxin
- 2282960..2283021 + 62 NuclAT_18 - Antitoxin
- 2282960..2283021 + 62 NuclAT_19 - Antitoxin
- 2282960..2283021 + 62 NuclAT_19 - Antitoxin
- 2282960..2283021 + 62 NuclAT_19 - Antitoxin
- 2282960..2283021 + 62 NuclAT_19 - Antitoxin
- 2282960..2283022 + 63 NuclAT_10 - -
- 2282960..2283022 + 63 NuclAT_10 - -
- 2282960..2283022 + 63 NuclAT_10 - -
- 2282960..2283022 + 63 NuclAT_10 - -
- 2282960..2283022 + 63 NuclAT_11 - -
- 2282960..2283022 + 63 NuclAT_11 - -
- 2282960..2283022 + 63 NuclAT_11 - -
- 2282960..2283022 + 63 NuclAT_11 - -
- 2282960..2283022 + 63 NuclAT_12 - -
- 2282960..2283022 + 63 NuclAT_12 - -
- 2282960..2283022 + 63 NuclAT_12 - -
- 2282960..2283022 + 63 NuclAT_12 - -
- 2282960..2283022 + 63 NuclAT_13 - -
- 2282960..2283022 + 63 NuclAT_13 - -
- 2282960..2283022 + 63 NuclAT_13 - -
- 2282960..2283022 + 63 NuclAT_13 - -
- 2282960..2283022 + 63 NuclAT_8 - -
- 2282960..2283022 + 63 NuclAT_8 - -
- 2282960..2283022 + 63 NuclAT_8 - -
- 2282960..2283022 + 63 NuclAT_8 - -
- 2282960..2283022 + 63 NuclAT_9 - -
- 2282960..2283022 + 63 NuclAT_9 - -
- 2282960..2283022 + 63 NuclAT_9 - -
- 2282960..2283022 + 63 NuclAT_9 - -
- 2282960..2283023 + 64 NuclAT_20 - -
- 2282960..2283023 + 64 NuclAT_20 - -
- 2282960..2283023 + 64 NuclAT_20 - -
- 2282960..2283023 + 64 NuclAT_20 - -
- 2282960..2283023 + 64 NuclAT_21 - -
- 2282960..2283023 + 64 NuclAT_21 - -
- 2282960..2283023 + 64 NuclAT_21 - -
- 2282960..2283023 + 64 NuclAT_21 - -
- 2282960..2283023 + 64 NuclAT_22 - -
- 2282960..2283023 + 64 NuclAT_22 - -
- 2282960..2283023 + 64 NuclAT_22 - -
- 2282960..2283023 + 64 NuclAT_22 - -
- 2282960..2283023 + 64 NuclAT_23 - -
- 2282960..2283023 + 64 NuclAT_23 - -
- 2282960..2283023 + 64 NuclAT_23 - -
- 2282960..2283023 + 64 NuclAT_23 - -
- 2282960..2283023 + 64 NuclAT_24 - -
- 2282960..2283023 + 64 NuclAT_24 - -
- 2282960..2283023 + 64 NuclAT_24 - -
- 2282960..2283023 + 64 NuclAT_24 - -
- 2282960..2283023 + 64 NuclAT_25 - -
- 2282960..2283023 + 64 NuclAT_25 - -
- 2282960..2283023 + 64 NuclAT_25 - -
- 2282960..2283023 + 64 NuclAT_25 - -
F3J96_RS11365 2283313..2284413 - 1101 WP_001313768.1 sodium-potassium/proton antiporter ChaA -
F3J96_RS11370 2284683..2284913 + 231 WP_001146444.1 putative cation transport regulator ChaB -
F3J96_RS11375 2285071..2285766 + 696 WP_000632706.1 glutathione-specific gamma-glutamylcyclotransferase -
F3J96_RS11380 2285810..2286163 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
F3J96_RS11385 2286348..2287742 + 1395 WP_000086194.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T139629 WP_000170954.1 NZ_CP043950:c2282907-2282800 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T139629 NZ_CP058753:40053-40535 [Klebsiella pneumoniae]
GTGGGACGTATAACCGCGCCCGAGCCGTTATCCAGCGCTCATCAGCTGGCTGAGTTCGTCAGTGGAGAGACAGTCCTCGA
TGAATGGCTAAAACAGAGAGGTTTAAAAAATCAAGCTCTTGGCGCTGCCCGAACGTTCGTTGTTTGCAAGACGGGTACGA
AGCAAGTAGCTGGTTTTTACTCTTTGGCCACCGGTAGCGTTAACCATACGGAAGCGACAGGCAGTCTTCGGCGTAACATG
CCAGATCCTATACCGGTGATTATACTCGCTCGCCTGGCGGTAGATGTCTCATTGCACGGAAAAGGGGTTGGCGCCGATTT
ACTTCACGATGCAGTTCTACGTTGTTATCGCGTAGCTGAGAATATTGGTGTTCGTGCGATAATGGTTCATGCGCTTACTG
AAGAAGCCAAAGGTTTCTATGCTCACCATGGATTTAAGGCATCACAAACTCATGAGCGGACTCTGTTCCTTAAACTTCCA
TGA

Antitoxin


Download         Length: 62 bp

>AT139629 NZ_CP043950:2282960-2283021 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9


Antitoxin

Download structure file

References